KEGG   Pandoraea pnomenusa RB38: DA70_09360Help
Entry
DA70_09360        CDS       T03067                                 

Gene name
tcuB
Definition
(GenBank) tricarballylate utilization protein B
  KO
K13795  citrate/tricarballylate utilization protein
Organism
ppno  Pandoraea pnomenusa RB38
Brite
KEGG Orthology (KO) [BR:ppno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    DA70_09360 (tcuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_9 Fer4_10 Fer4 Fer4_2 DUF3088 Fer4_6 Fer4_7 NDUF_B12 Fer4_21 Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AHN74652
LinkDB All DBs
Position
1508484..1509701
Genome map
AA seq 405 aa AA seqDB search
MQKSDAIPSEQGPSLAPLVSKPAGAGARGKAARVIPIVALNPGEAEVARQMQICNACRYC
EGFCAVFPAMTRRLEFAKADVHYLANLCHNCGACYHACQYAPPHEFAVNVPKAMAQVRLE
TYSEYAFPAAFGALYRRNGVTLSIALAAGISLFLLLGLGLRGGLAPSSAPADFYAIFPHN
LLAVMFGAVFLFAALALGIGVRRFWRDVAPGTASVPAVSEAARHALTLKYLDGGHGEGCN
EADDAFTLARRRFHHLTFYGFMLCFGATVVATLYHYAFGLEAPYPVLSVPVVLGVLGGAG
LIVGPTGLLWLNVRRDPARTDTRQRPMDRGFIALLLLTSASGLGLLACRTTAAMPTLLAL
HLGIVMALFATLPYGKFAHGIFRSAALLKSSIERRQRNTLSLGSE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagtctgacgcaatcccctccgagcaaggtccttcgttggcgccgctcgtttcg
aagcccgccggcgcgggcgcacgaggcaaggccgcgcgcgtgattcccatcgtcgcgctt
aatccaggcgaggcggaagtcgcgcgtcagatgcagatctgcaacgcctgccgctattgc
gagggattttgcgccgtattcccggcaatgacgcgccgcctcgaattcgccaaggcagat
gtgcactacctcgccaatctctgccacaactgcggtgcctgttatcacgcgtgccagtac
gcgccgccccatgagttcgccgtcaacgtgcccaaggcgatggctcaagtgcgcctcgag
acctattccgagtacgcgtttcccgcagcgttcggcgcgttgtaccggcgcaatggggtg
accttgtccatcgcgctggcggccggcatttcgctgttcctgctgctgggcctgggactg
cgcggcggccttgcgccgagcagcgcgcctgcggacttctatgcgatctttccgcacaac
ctgctcgccgtgatgttcggggcggtgttcctgttcgccgcgctcgcattgggtattggc
gttcggcggttctggcgcgacgttgcgccggggacggcaagcgtgcccgcggtgagcgag
gccgcccgtcacgcgctgacgctcaagtatctcgacggcggccacggcgagggctgcaac
gaagcggacgacgccttcacgctcgcgcggcgccgtttccatcacctgaccttttacggc
ttcatgctttgctttggcgcgaccgtcgtggcaacgctctatcactatgcatttggcctc
gaggccccgtatccggtcctgagcgttcccgtggtgctgggcgtgctcggtggcgccggg
ctcatcgtggggccgacggggctgctgtggctgaacgtccggcgcgatcccgcgcgcacc
gacacacgccagcgcccgatggatcgcggcttcatcgcgctcctgctgttgaccagcgcg
tcgggcctcggattgctcgcgtgccggacaactgccgcgatgccgacgttgctcgcgctt
cacctgggcatcgtcatggcgctgttcgcaacgctgccttacgggaagttcgcccacggc
atctttcgcagtgcggcattgctcaagtcgtccatcgagaggcggcagcgcaacaccctg
agcctgggctcggaatag

DBGET integrated database retrieval system