KEGG   Pandoraea pnomenusa RB38: DA70_09945Help
Entry
DA70_09945        CDS       T03067                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00620  Pyruvate metabolism
ppno00680  Methane metabolism
ppno01100  Metabolic pathways
ppno01120  Microbial metabolism in diverse environments
ppno01200  Carbon metabolism
Module
ppno_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ppno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DA70_09945
  09102 Energy metabolism
   00680 Methane metabolism
    DA70_09945
Enzymes [BR:ppno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DA70_09945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALU64318
LinkDB All DBs
Position
complement(1393872..1396826)
Genome map
AA seq 984 aa AA seqDB search
MKSSAKAKAPREGLAKSVGNTPPAKAAAAAPSTPRPAKRVPDAAAAPKTRRSREDKDAPL
REDIRFLGRLLGDVLREQQGSDAFDLVETIRQNAVRFHREGDRSAAKALDTLLNGLTNEQ
AIQVVRAFSYFSHLANIAEDRHHNRRRRVHALAGSRAQPGTIRAALQSLKDAGRADPATL
QAFFASALIVPVLTAHPTEVQRKSILDAEREVARLLEHRDDALTERESSRNTESMRAYVT
TLWQTRMLRSSRLTVADEIENALSYYRSTFLSEIPALYDDVAAELHDAVPSVRAEGLGRF
LQMGSWIGGDRDGNPNVTAQTLQLAITRQATEIFAHYLEEVHLLGAELSVSQLLAGASDA
LLTLARRSPDDSPHRTDEPYRRALIGVYARLAATAREWVGHVPHRGAVGDASPYLDASEF
ISDLNTVVASLVAHHGSALISQRLGPLVRAAEVFGFHLASIDLRQSSDVHEAVIAELFAK
AGVEANYAKLDEAAKLALLLRELREPRALFSPYLDYSQRTRDELAVFAAAREIRARFGAR
AVRNYIISHTETVSDLVEVMLLQKETGLFQGALGGKGAKGVEPKVGAMVIPLFETIADLR
NAPVIMREFFDIPGMSEVVVQQGGEQEVMLGYSDSNKDGGFLTSNWELYKAELALVRLFE
EKGIRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEIIASKFANPEIGRR
NLETIVAATLEATLLPSRNQPPRLAAYEQVMQALSDTAFAAYRDLVYETPGFTDYFFSAT
PIAEIAELNIGSRPASRKFSDPKNRRIEDLRAIPWGFSWGQCRLLLTGWYGFGSAVSAYL
DDGDAAGRDKRLDTLRQMVKRWPFFANLLSNMDMVLAKTDLAVASRYAELVPDEKLRKRV
FSRIVAEWQGTTQALALITGHDERLADNPLLARSIKNRFPYLDPLNHLQVELLRRHRAGE
SDERARRGIHLSINGIAAGLRNTG
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcagcgcaaaggcaaaagccccgcgagagggcctcgccaagtcggtcggcaac
actccccccgcgaaggcagcagccgcggcaccatccactccccgcccggcgaaacgcgtg
ccggacgccgccgcggcaccgaagacccgccgttcgcgcgaagacaaggacgccccgctg
cgcgaggacattcgcttcctcggccgcctgctcggcgacgtcctgcgcgagcagcagggc
agcgatgcgttcgatctcgtcgaaaccatccgccagaatgccgtgcgctttcaccgcgag
ggcgatcgcagcgccgcgaaggcgctcgacacgctgctcaacggcctgaccaatgaacag
gcgatccaggtggtgcgtgcgttcagctacttttcgcatctggcgaacatcgccgaggac
cggcatcacaaccgccgccgccgcgtgcacgcgctcgcgggcagccgcgcccagccgggc
acgattcgcgccgcgctgcaaagcctgaaggacgccggtcgcgccgatcccgccacgctc
caggccttcttcgccagcgcgctcatcgtgccggtgctgaccgcccacccgacggaagtc
cagcgcaagagcattctcgacgcggagcgcgaggtcgcccgcctgctcgaacatcgcgac
gacgcgctcaccgagcgcgaatcctcgcgcaacaccgagtcgatgcgtgcctacgtgacc
acgctctggcagacgcgcatgctgcgcagctcgcgcctgacggtggccgacgagatcgag
aacgcgctgtcgtactaccgcagcacgttcctgtccgaaattcccgcgctgtacgacgat
gtggccgccgagctgcacgacgccgtgcccagcgtgcgcgccgaaggtctcggacgtttc
ctgcaaatggggagctggatcggcggcgatcgcgacggcaacccgaacgtgaccgcccag
accctgcaactggccatcacgcgccaggccacggaaatcttcgcgcactacctcgaagaa
gtgcacttgctgggcgcggaactctccgtctcgcagctgctcgccggcgccagcgacgcg
ctgctcaccctggcgcgccgctcgcccgacgactcgccgcaccgcaccgacgagccctat
cgccgtgcgctgatcggcgtgtatgcgcgcctggccgcgaccgcgcgcgagtgggtcggc
cacgtgccgcatcgcggcgcggtcggcgacgcaagcccatatctcgacgccagcgaattc
atctccgatctgaacacggtcgtcgcgtcgctcgtggcgcatcacggcagcgcattgatt
tcgcaacgcctcggcccactggtgcgcgccgccgaggtgttcggcttccatctcgcgagc
atcgacctgcgccaaagctccgacgtgcacgaagccgtgattgccgagctattcgccaag
gcgggcgtcgaagcgaactacgcgaaactcgacgaagcggccaagcttgcgctgctgttg
cgcgaactgcgcgagccgcgtgcgctcttctcgccgtatctcgactactcgcaacgcacg
cgcgacgagctggccgtattcgccgccgcacgtgagattcgcgcccgcttcggcgcgcgc
gcggtgcgcaactacatcatttcgcacacggaaaccgtgagcgatctggtcgaagtcatg
ctgctgcaaaaggagacgggcctgtttcagggcgcgctgggcggcaagggcgcgaagggc
gtcgagccgaaggtcggcgccatggtcattccgctgttcgagacgatcgccgacctgcgc
aatgcgccggtcatcatgcgcgagttcttcgacattcccggcatgtccgaggtcgtggtg
cagcaaggcggcgagcaggaagtcatgctcggctattccgacagcaacaaggacggcggc
ttcctcacgtcgaactgggagttgtacaaggccgaactcgcgctggtgcgcctgttcgag
gagaaaggcatccgcctgcgcctgttccacggccggggcggcaccgtcggacgcggcggc
ggcccgacctatcaggccatcctctcgcaaccgccgggtaccgtgaacggacagattcgc
ctgaccgaacagggcgagatcatcgcgagcaagttcgccaatccggaaatcggacggcgc
aatctcgagacgatcgtggccgccacgctcgaagccacgctgctgccgagccgcaaccag
ccgccgcgcctggccgcatacgagcaggtcatgcaggcactgtcggacacggcatttgcc
gcgtatcgcgacctcgtctatgaaacgccgggcttcaccgactatttcttctcggccacg
ccgatcgcggaaatcgccgagctcaacatcgggtcgcgccccgcttcgcgcaagttctcc
gaccccaagaaccgccgcatcgaggaccttcgcgccattccatggggcttctcgtggggg
caatgccgcttgctgctcaccggttggtacggtttcggcagcgcggtgagcgcgtatctg
gacgacggcgacgccgccggccgggacaagcgcctcgacacgctgcgtcagatggtcaag
cgctggccgttcttcgcgaatctgctctcgaacatggacatggtgctcgccaagaccgac
ctggccgtggcctcgcgttacgccgagctggtaccggacgaaaaactgcgcaagcgcgtg
ttcagccgcatcgtggccgaatggcagggcacgacgcaggcgctcgcgctgatcaccggc
catgatgagcgcctggccgacaacccgctgctcgcacgctcgatcaagaatcgcttcccg
tacctcgatccgctcaatcacttgcaggtcgagttgctgcggcgccaccgcgcgggtgag
tcggacgaacgcgcgcggcgcggcatccacctgtccatcaacgggatcgcggccggtctg
cgcaacaccggctga

DBGET integrated database retrieval system