KEGG   Pandoraea pnomenusa RB38: DA70_15340Help
Entry
DA70_15340        CDS       T03067                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00970  Aminoacyl-tRNA biosynthesis
ppno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppno00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DA70_15340 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ppno03029]
    DA70_15340 (gatB)
Enzymes [BR:ppno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DA70_15340 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DA70_15340 (gatB)
Mitochondrial biogenesis [BR:ppno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DA70_15340 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AHN75683
LinkDB All DBs
Position
209230..210711
Genome map
AA seq 493 aa AA seqDB search
MNLMQWEVVIGLETHAQLSTASKIFSGASTQFGAAPNTQACPVDLALPGVLPVLNRGAVE
RAIEFGLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGSLKIQVDADPRTGR
EAYEKVVTLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYA
KALHGLVVWLGICDGNMQEGSFRCDANVSVRPVGQKAFGTRAEIKNLNSFRFLEEAIQYE
VRRQIELIEDGGEVVQETRLYDPDKKETRSMRSKEDAHDYRYFPDPDLMPLVIDSEWIDR
VRAALPELPAGMQARFVETYGLSDYDAAVLTQSKAQAAYFEAVVAKAGKASAKPAANWIM
GELSSLLNREDLTIEASPVSSAQLAGLLARIADNTISNKIAKEVFQLMWEERATDDAAAD
RIIEAKGLKQITDTGAIEKIIDEVLAANAKSVDEFRAGKEKAFNALVGQAMKATKGKANP
AQVNELLKKKLGA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccttatgcaatgggaagtcgttattggtctggagacgcacgcacagctctccacc
gcttccaagattttctcgggcgcgtcgacgcagttcggcgccgcccccaacacgcaggcc
tgcccggtggatctggcgctgccgggcgtgctgcccgtgctcaatcgcggcgcggtggag
cgcgcgatcgagttcggtctggccattggcgccacgatcgcgccgcgcagcattttcgcg
cgcaagaattacttctatcccgatctgcccaagggctatcagatcagccagtacgagatc
ccggtggtgcagggcggctcgctgaagattcaggtcgacgccgacccgcgcaccggccgc
gaggcttatgaaaaggtcgtcacgctcacgcgcgcgcacctggaggaagacgcgggcaag
tcgctgcacgaggacttcgcgggcatgacgggcatcgatctgaaccgcgccggcacgccg
ctgctggagatcgtgaccgaacccgacatgcgcagcgcggccgaggccgtggcttacgcc
aaggcgctgcacggcctggtcgtgtggctcgggatctgcgacggcaacatgcaggaaggg
tcgttccgttgcgacgcgaacgtgtccgtgcggcccgtcggccagaaggcgttcggcacg
cgcgccgagatcaagaacctgaactcgttccgctttctcgaagaagcgattcagtacgaa
gtgcgccgtcagatcgaactgatcgaggatggtggcgaagtggtgcaggaaacgcgtctg
tacgatccggacaagaaggaaacgcgttcgatgcgcagcaaggaagacgcgcacgactac
cgctacttcccggacccggacctgatgccgctcgtgatcgacagcgaatggatcgatcgc
gtgcgcgccgcgctgcccgagctgcctgcgggcatgcaggcgcgctttgtcgaaacgtat
ggcctgtccgactacgacgccgcggtgctcacgcagtcgaaggcgcaggccgcctacttc
gaagccgtggtcgccaaggccggcaaggcgagcgccaagccggccgcgaactggatcatg
ggcgagctgtcgtcgctgctcaatcgcgaagacctgaccatcgaggccagcccggtctcg
agcgcccaactggccggattgctcgcacgcatcgccgacaacacgatctcgaacaagatc
gccaaggaagtcttccaactgatgtgggaggagcgtgccaccgacgacgccgccgccgat
cgcatcatcgaggcgaaggggctgaagcaaatcacggacaccggtgcgatcgagaagatc
atcgacgaagtgctggcggccaacgccaagtccgtcgatgaattccgcgcgggcaaggag
aaggcgttcaacgcgctggtcggtcaggcgatgaaggccaccaagggcaaggcgaacccg
gcgcaggtcaacgaactgctcaagaagaagctcggcgcctga

DBGET integrated database retrieval system