KEGG   Pandoraea pnomenusa RB38: DA70_18055Help
Entry
DA70_18055        CDS       T03067                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00550  Peptidoglycan biosynthesis
ppno01100  Metabolic pathways
ppno01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ppno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DA70_18055
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    DA70_18055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ppno01003]
    DA70_18055
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppno01011]
    DA70_18055
Enzymes [BR:ppno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     DA70_18055
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DA70_18055
Glycosyltransferases [BR:ppno01003]
 Polysaccharide
  Bacterial polysaccharide
   DA70_18055
Peptidoglycan biosynthesis and degradation proteins [BR:ppno01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   DA70_18055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB PIG-P SHOCT
Motif
Other DBs
NCBI-ProteinID: AHN76141
UniProt: A0A378YMJ0
LinkDB All DBs
Position
4979063..4981516
Genome map
AA seq 817 aa AA seqDB search
MASTPQTETPRDKRPPKPRRSLWLRLALWFVGLIAAMVVCGALLAGYILVVMTPQLPSLD
TIVDYRPKIPLRIYTADEIQIGEFGEERRNLVRFADIPDVMKKAVLAIEDDRFYQHGGVD
FIGIFRAGVANFARGGSSQGASTITMQVARNFFLSSEKTYTRKIYEALLAYKIESRLTKD
QILELYMNQIYLGERAYGFASAARVYFGKDLKDITLAEAAMLAGLPKAPSAYNPIVNYKR
ARVRQEYILKRMFDLGYISKDEYDQAIAQELVVRGLGSEFSVHAGYVAEMVRQLLYAQFK
DEIYTRGFNVYTTINSADQEAAYEALRAGVMAYELRHGYRGPEANIDLPDDQDEREQLID
DTLVEHPDSGDMVAAVVLSASPQQVKAVLLNGDDVTVTGDGLRFAAAGLSAKAQPKQKIR
RGSVIRVTKDEKDNWRIVQMPDIEAAFVSLDPQNGAIRSLVGGFDFNRNKFNHVTQAWRQ
PGSSFKPFIYSAALEKGFAPATIINDGPLYFTAAQTGGQPWEPKNYGGGFEGPMPMRVAL
MRSRNLVSIRILQSITPAYAQKFIGRFGFEADKHPAYLPMALGAGMVTPLQMASAYAVFA
NGGFRVNPFIVARITDSKGNVIMEEKPATAGDETIRAIPARNAFIMNSMLHDVATRGTAA
KTNVLKRSDLAGKTGTTNDSHDAWFAGYQSQLVGVAWIGFDQPRNLGDRETGGGLALPIW
INYMSKALRGVQESTRTMPSGVIQANGDYFYDDYPPGRAVSTVGLSADTTPDGAAAPGPS
TGALPGQMPAQPGPSPAPAPVDRQERQRILDMFNSKP
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcacaccccaaaccgagacaccccgcgacaagcgcccgcccaaaccgcgccgc
tccctctggctgcgcctcgcgctttggttcgttggcctgatcgccgcgatggtcgtatgt
ggcgcgctgctcgcggggtacatcctggtggtgatgacgccgcagttgccgtcgctcgac
accatcgtcgactaccggccgaagattccgctgcgcatctacaccgccgacgaaatccag
atcggcgagttcggcgaggagcgccgcaatctcgtgcgcttcgccgacattcccgacgtc
atgaagaaggccgtgctcgccatcgaggacgaccgcttctaccaacacggcggggtcgac
ttcatcggcatcttccgcgcgggcgtggccaatttcgcccgtggcggctcctcccagggt
gccagcacgatcacgatgcaggtcgcgcgcaacttcttcctgtcgagcgaaaaaacctac
acgcgcaagatttacgaggccctgctcgcctacaagatcgagtcgcggctgaccaaggat
cagattctcgagctgtacatgaatcagatctatctgggcgagcgcgcgtacggtttcgcc
agcgctgcgcgcgtctacttcggcaaggacctcaaggacatcacgctggccgaggccgcc
atgctcgccggcctgccgaaagccccgtcggcgtacaacccgatcgtcaactacaagcgc
gcacgcgtgcgtcaggaatacatcctgaagcggatgtttgacctcgggtacatctcgaag
gacgagtacgaccaggcgattgcgcaggaactcgtggtgcgaggcctgggcagcgagttc
agcgtccatgcgggatacgtcgccgaaatggtccggcaactgctctacgcccagttcaag
gacgagatctatacgcgcggcttcaacgtctacaccacgatcaactccgccgatcaggaa
gcggcctacgaggcgctgcgcgcaggggtgatggcctacgagcttcgccatggctaccgt
ggccccgaagccaacatcgacctgcccgacgatcaggacgagcgcgagcaattgatcgac
gacacgctcgtcgagcaccctgacagcggggacatggtggcggccgtggtgctgtccgcg
tcgccgcaacaggtcaaggccgtgctcctgaacggcgacgacgtgaccgtgaccggcgac
ggcctccggtttgcggcggcgggcctgagcgccaaggcacagccgaagcagaagattcgc
cgtggctcggtgatccgcgtgacgaaggacgagaaggacaactggcgcatcgtgcagatg
ccggacatcgaggccgcgttcgtgtcgctcgatccgcaaaacggcgccatccgatcgctc
gtcggcgggttcgacttcaatcgcaacaaattcaatcacgtgacgcaggcgtggcgtcag
ccggggtcgagcttcaagccgttcatctactccgctgcgctcgaaaagggatttgcaccc
gccacgatcatcaacgacggcccgctgtatttcacggcggcacagaccggcgggcagccg
tgggagccgaagaactacggcggtggattcgaaggcccgatgccgatgcgcgtggcgctg
atgcgctctcgcaacctcgtgtcgatccggattctgcagagcatcaccccggcctacgca
cagaaattcatcggccgattcggcttcgaggccgacaagcatccggcctatctgccgatg
gcgctgggcgccggcatggtcacgccgctccagatggcaagcgcgtatgccgtgttcgcc
aacggcggcttccgtgtgaatccgttcattgtggcgcgcatcacggactcgaagggtaac
gtcatcatggaagaaaagccggcgacggcgggtgacgagacgatccgggcgattcccgcg
cgcaacgcattcatcatgaactcgatgctccacgacgtggctacgcgaggcacggcagcc
aagaccaacgtgctcaagcgcagcgacctggcaggcaagaccggaacgacgaacgattcg
cacgatgcctggttcgcaggctatcaatcccaactggtgggcgtggcttggattggcttc
gatcagccgcgcaacctgggcgatcgcgaaacgggcggtggcctggcattgccgatctgg
atcaactacatgtcgaaggcgctgcgaggggtgcaggagtcgacgcgcaccatgccgtcc
ggcgtcattcaggccaacggggattacttttacgacgactacccgccgggtcgcgccgtc
agcacggtgggcctgagcgcagataccacgccggacggggcggccgcaccgggcccgtcg
acaggcgcgctgcctggccagatgccggcgcaaccgggcccgtcacccgcgccggcaccg
gtggaccggcaggaacgtcagcgtattctggacatgttcaacagcaagccctga

DBGET integrated database retrieval system