KEGG   Pandoraea pnomenusa RB38: DA70_19005Help
Entry
DA70_19005        CDS       T03067                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00473  D-Alanine metabolism
ppno00550  Peptidoglycan biosynthesis
ppno01100  Metabolic pathways
ppno01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DA70_19005
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DA70_19005
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    DA70_19005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppno01011]
    DA70_19005
Enzymes [BR:ppno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DA70_19005
Peptidoglycan biosynthesis and degradation proteins [BR:ppno01011]
 Precursor biosynthesis
  Amino acid ligase
   DA70_19005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATPgrasp_Ter ATPgrasp_ST ATP-grasp_4 TTL CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AHN76309
UniProt: V5UCZ4
LinkDB All DBs
Position
complement(4773812..4774795)
Genome map
AA seq 327 aa AA seqDB search
MSAFDPKRFGKVGVLMGGRSAERQISLISGKGVLEALRSKGVDAHGFDTGMNDLAALAAQ
KFDRVFIALHGRYGEDGTLQGALEHLGIPYTGSGVLASALAMDKEMTKRVWINEGLPTPR
FKMLDADSDFDAVARDLGLPLIVKPSREGSTIGLTKVTEASQLKAAYEKAAALDPDVLAE
EFIDGDELTVPVLGVGTKGAAAARALPVIRIVAPDANYDYQNKYFKDDTRYECPPPLSVS
LQEEVQRLVLRAYLVLGCRGWARADVMLRKRDNKPYLLEINTSPGMTGHSLVPISARAAG
LSYEDLVVEILATATLDLHPNAQWKPE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcattcgatccgaaacgtttcggcaaggttggcgtcctgatgggcgggcgctct
gccgagcgtcagatctcgctgatttcgggcaaaggcgtactcgaggcgctgcgcagcaag
ggcgtggacgcccacggtttcgataccggcatgaacgatctggcggcgctggccgcgcag
aagttcgaccgcgtgttcattgcgctgcatgggcgctacggcgaggacggcacgctgcag
ggtgcgctcgagcatctcggcattccctacaccggcagtggcgtgctcgcctcggcgctg
gcgatggacaaggaaatgaccaagcgcgtgtggatcaacgaaggcctgcccacgccgcgc
ttcaagatgctcgacgccgacagcgacttcgacgccgtggcgcgcgatctcggcctgccg
ctgatcgtcaagccgtcgcgcgaaggctcgaccatcggcctcacgaaggtcacggaagcg
tcgcagctcaaggcggcctacgagaaggctgccgcgctcgatcccgacgtgctcgccgag
gagttcatcgatggcgacgagctgaccgtgccggtgttgggcgtgggcacgaagggcgcg
gccgccgcgcgcgcgctgccggtgatccgcatcgtggcgccggacgcgaactacgactat
cagaacaagtacttcaaggacgacacgcgctacgagtgcccgccgccgttgtcggtgtcg
ttgcaggaggaagtgcagcgcctcgtgttgcgcgcctacctggtgctgggatgccggggc
tgggcgcgagccgacgtgatgctgcgcaagcgcgacaacaagccgtacctgctggaaatc
aatacgtcgccgggcatgaccggtcactcgctggtgccgatctcggcacgtgcggcgggc
ctgtcgtatgaagacctggtcgttgaaatcctggcaaccgcgacgctcgatctgcatccg
aacgcgcagtggaagccagagtga

DBGET integrated database retrieval system