KEGG   Pandoraea pnomenusa RB38: DA70_24380Help
Entry
DA70_24380        CDS       T03067                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00020  Citrate cycle (TCA cycle)
ppno00480  Glutathione metabolism
ppno01100  Metabolic pathways
ppno01110  Biosynthesis of secondary metabolites
ppno01120  Microbial metabolism in diverse environments
ppno01130  Biosynthesis of antibiotics
ppno01200  Carbon metabolism
ppno01210  2-Oxocarboxylic acid metabolism
ppno01230  Biosynthesis of amino acids
Module
ppno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppno_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ppno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DA70_24380
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DA70_24380
Enzymes [BR:ppno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DA70_24380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AHN77256
LinkDB All DBs
Position
3606631..3608871
Genome map
AA seq 746 aa AA seqDB search
MSTQQSSIIYTLTDEAPLLATGAFLPIIRTFTAPAGVAIETSDISVAGRILGEFPEFLTE
EQRVPDNLAELGRLTQDPDTNIIKLPNISASVFQLQSAIKELQSKGYKVPDYPEDPKTDE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPLAVKNYAKKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTIDKACDVRMELVTKSGKTIVLKPKVSLLDGEIIDSMFMSKKALCEFYEE
QMEDARKTGVMFSLHVKATMMKVSHPIVFGHAVKIFYKEAFEKHGKLFDELGVNVNNGLV
NLYEKIEALPSTQREEIIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
LGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGAFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIVEDGVANIVNIATGEVLLSQNVEAGDIWRMCQVKDAPIRDWVKLAVNRV
RNSGMPAVFWLDPYRPHEAELIKKVETYLKDHDTTGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDLGIKTGNNRAKILAKTLDAATGKLLDNNKGPSPKTGELDNR
GSQFYLSMYWAQELAEQKEDAELAQRFAPLAKRLAENEKTIVAELAEVQGKPADIGGYYK
PDFDKLEQVMRPSKTFNAALASVATA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcagcaatccagcatcatctacaccctgaccgacgaagcaccgcttctggcc
accggcgccttcctcccgatcattcgcacgttcaccgcgccggccggcgtggcgatcgag
acgagcgacatctcggtggcaggtcgtatcctcggcgaattccccgaattcctgacggaa
gaacagcgcgtgccggacaacctcgccgagttgggccgcctcacgcaggatccggacacc
aacatcatcaagctgccgaacatcagcgcttcggtgttccagttgcagagcgccatcaag
gagctccaatcgaagggctacaaggtgccggactatccggaagacccgaagaccgacgaa
gagaaggccatccagaagcgctactcgaagtgcctgggctcggccgtgaacccggtgctg
cgcgaaggcaattcggatcgccgcgccccgttggccgtgaagaactacgccaagaagcat
ccgcacagcatgggcgaatggagcatggcttcgcgcactcacgtggcgcacatgaagcac
ggcgacttctaccacggcgaaaagtcgatgacgatcgacaaggcttgcgacgtgcgcatg
gaactcgtgacgaagagcggcaagaccatcgtgctcaagccgaaggtctcgctgctcgac
ggcgaaatcatcgacagcatgttcatgagcaagaaggcgctgtgcgagttctacgaagaa
cagatggaagacgcccgcaagaccggcgtcatgttctcgctgcacgtgaaggccaccatg
atgaaggtctcgcacccgatcgtgttcggccacgccgtgaagatcttctacaaggaagcc
ttcgagaagcacggcaagctgttcgacgaactgggcgtgaacgtcaacaacggcctcgtg
aacctgtacgagaaaatcgaggcgctgccgagcacgcaacgtgaagagatcatccgcgat
ctgcacgcctgccacgagcaccgtccggaactggcgatggtcgactcggccaagggcatc
tcgaacctgcacgcaccgaacgacgtgatcgtcgatgcctcgatgccggccatgatccgc
ctgggcggcaagatgtggggcgccgacggccgtccgaaggacaccaaggccgtgatcccg
gagagcacgttcgcccgcatttaccaggaaatcatcaacttctgcaagacgaacggcgca
ttcgacccgaccaccatgggcacggtgccgaacgtcggcctcatggcgcagaaggcagaa
gagtacggctcgcacgacaagacgttcgaaatcgtcgaagacggcgtggcgaacatcgtc
aacatcgccacgggcgaagtgctgctctcgcagaatgtggaagccggcgacatctggcgc
atgtgtcaggtcaaggacgccccgatccgcgactgggtaaagctcgcggtgaaccgcgtt
cgcaactcgggcatgccggccgtcttctggctcgacccgtaccgtccgcacgaagccgaa
ctgatcaagaaggtcgagacgtacctgaaggaccacgacaccaccggcctcgatatccag
atcatgtcgcaagtgcgcgccatgcgttacacgctcgagcgcgtgatccgcggcctggac
accatttcggtgaccggcaacattctgcgcgactacctgaccgacctcttcccgatcatg
gagctgggcaccagcgccaagatgctgtcgatcgtgccgctgatggccggtggcggcatg
tacgaaacgggcgccggcggctcggcaccgaagcacgtcaagcaactggtcgaggagaat
catctgcgttgggactcgctgggtgaattcctggcgctggccgtgtcgctggaagacctc
ggtatcaagacgggcaacaaccgcgccaagatcctcgccaagacgctcgacgcggcaacc
ggcaagctgctggacaacaacaagggcccgtcgcccaagaccggcgagctcgacaatcgc
ggcagccagttctatctgtcgatgtactgggcacaggaactcgccgagcagaaggaagac
gccgagctggcccagcgcttcgcgccgctggccaagcgactggccgagaacgagaagacg
atcgtggccgaactcgccgaagtacaaggcaagccggccgacatcggtggctactacaag
cccgacttcgacaagctcgagcaagtcatgcgcccgagcaagacgttcaacgccgcgctg
gcaagcgtcgcgacggcgtaa

DBGET integrated database retrieval system