KEGG   Paenibacillus polymyxa M1: PPM_1196Help
Entry
PPM_1196          CDS       T01968                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00473  D-Alanine metabolism
ppo01100  Metabolic pathways
ppo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PPM_1196 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PPM_1196 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppo01011]
    PPM_1196 (alr)
Enzymes [BR:ppo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PPM_1196 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ppo01011]
 Precursor biosynthesis
  Racemase
   PPM_1196 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: CCC84133
LinkDB All DBs
Position
1456172..1457368
Genome map
AA seq 398 aa AA seqDB search
MQAQYRSTRAEINLDHLGANYEAFRKVLPADKLILVCVKANAYGHGAVEISKEMERLGAD
YLSVAFLDEALELRHAGIELPILVLGYTSPEAVQTAWEHDISLTVFSEEVLEGIRRLDRQ
GSERKLKVHIKIDSGMGRLGLLPGEAALAFVRQAHELEQVLLEGMYTHFARADEEDKSYT
LLQYDRFRGVADALREQGITIPIIHTGNSAATIDTPSLSPNMVRIGISIYGLYPSDEVNR
QVIELLPVLSLKTAVVYTKTLPPGWGVSYGTRYVTSSEERIGTLPIGYADGYSRMLSGKV
EVLIRGRRVPVLGTICMDQCMVSLQSFAEDAEEIQTGEEVVLIGQQSGEIIAADELASKL
GTIHYEVICMIADRVPRVYMRDHVPVVRVNSLLPTHWN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagcacaatacagatcgacccgggccgaaatcaacctggatcaccttggcgccaac
tatgaagcctttcgcaaggtattgcctgcggataagctgatactggtctgtgtcaaggct
aatgcctacgggcacggtgccgtagaaatttcaaaggaaatggaacgccttggtgcggat
tatttgagcgtcgcttttctggatgaggctcttgagcttcgtcatgcggggattgaactg
ccgatccttgtactcggctatacctcgcctgaagctgtccaaacagcttgggagcatgat
atctcattgactgtgtttagtgaggaagtgctggaaggtatccgcagattggaccgccaa
ggaagcgaacgcaagctgaaggtgcacatcaaaatagacagcggcatgggaagactcggt
ttgctgcctggagaagcggctttggcttttgtccggcaggctcacgaattagagcaggtg
ctgctggaaggcatgtacacccattttgcccgcgcggatgaagaagataaaagctataca
ctgctacaatatgatcggtttcggggcgtggcggatgcgctaagggaacaaggtattact
attcccattatacatacgggcaacagcgcggccaccattgataccccttccctttccccc
aatatggtgcggattggcatcagtatatacggtttgtatccgtctgatgaggttaaccgg
caagtcattgaactgttgcctgtattgtcattaaagacggcggtggtttataccaagacg
cttcctcctggatggggagttagttatggtacccggtatgtgacctctagtgaagagcgg
atcggcacactgccaatcggttatgcggatggatattctcgcatgctaagtgggaaggtt
gaagtgttgatacgcggtcgtcgcgtccctgtactcggtacgatctgcatggaccagtgt
atggtatccttacaatctttcgcagaggatgcggaagaaatccaaaccggcgaagaggtt
gttctcatcggccagcagtccggcgaaatcattgcggcggatgagctggcatccaagctt
ggtacgatccactatgaggtgatctgcatgatcgcagacagggtaccgcgtgtttacatg
cgagatcatgttcctgtcgttcgggtgaactcgcttcttccaacccactggaattaa

DBGET integrated database retrieval system