KEGG   Paenibacillus polymyxa M1: PPM_1575Help
Entry
PPM_1575          CDS       T01968                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00020  Citrate cycle (TCA cycle)
ppo00480  Glutathione metabolism
ppo01100  Metabolic pathways
ppo01110  Biosynthesis of secondary metabolites
ppo01120  Microbial metabolism in diverse environments
ppo01130  Biosynthesis of antibiotics
ppo01200  Carbon metabolism
ppo01210  2-Oxocarboxylic acid metabolism
ppo01230  Biosynthesis of amino acids
Module
ppo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ppo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPM_1575 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PPM_1575 (citC)
Enzymes [BR:ppo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PPM_1575 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CCC84512
LinkDB All DBs
Position
1859825..1861120
Genome map
AA seq 431 aa AA seqDB search
MAKFEKFELPTEGEKITIDNGQLQVPNHPVIPFIEGDGTGRDIWKASKRVLDAAVEKAYN
GTKKIAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFNGVPSPVKRPELVDMVIFRENTEDIYAGIEYAEGSEDVKKVIQFLQ
QELDVNKIRFPETSGIGIKPVSSEGSKRLVRAAIQYAVDHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEQEFADKVFTWAQYDVIKEKEGEDAANAAQKAAEDAGKIIIKDAIADIALQ
QVLTRPSEFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWKEAADLIYKGLETSINKKIVTYDFARLMDGATQVKC
SEFADTIISNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatttgaaaagtttgagctcccaactgaaggcgaaaaaattacgattgataac
ggtcaactgcaggttccaaaccatccggtcattccgtttatcgaaggtgacggcacaggt
cgcgacatctggaaagcttccaagcgcgtactggacgcagctgtagaaaaagcatataac
ggcacgaaaaagattgcctggtatgaagtattcgctggtgagaaagctttcaatacatac
ggcgagtggctccctaacgatacgttggaagccatccgtgagtatattgtagccattaaa
ggtccacttacgacacctattggcggtggtatccgttcattgaatgtggcattgcgccaa
gaactggatttatacgtatgtctgcgtcctgttcgttactttaacggtgtcccgtctcca
gtaaaacgtcctgagttggtggacatggtcattttccgtgagaacacagaagatatctac
gcagggatcgaatatgccgaagggtccgaagacgtgaaaaaggtgattcagttccttcag
caagagctggacgtgaataaaatccgtttccctgaaacttcaggaattgggatcaagcca
gtgtcttccgagggttcaaagcgtctggtacgggcagctattcagtatgctgttgaccac
ggacgcaagagtgtaacgctcgtacacaaaggtaacattatgaaatttaccgaaggtgcc
ttcaagaactggggctatgaagtagccgagcaagaatttgcagataaagtatttacttgg
gcccagtatgatgtcatcaaggaaaaagaaggtgaggatgcggcaaatgcagctcaaaaa
gcagctgaagatgcgggcaaaatcattatcaaggatgcgattgctgatattgcacttcag
caggtgctgactcgtccttctgaatttgatgtcattgctacgctgaacctgaacggggac
tatctgtccgatgctcttgctgctcaagttggtggaattggtatcgcgccaggtgcaaac
attaactatgtaaccgggcatgctatctttgaagctacacatggtacagctccaaaatat
gctgacaaagacgtagtgaacccaggttccgtaattctgtccggcgtcatgctgctagaa
cacttgggttggaaagaagcagctgacctgatttacaaaggactggagacgtccattaat
aagaagattgtaacttatgactttgcccgtctgatggatggtgctacacaggtgaaatgc
tccgagttcgcggataccattattagtaacctgtaa

DBGET integrated database retrieval system