KEGG   Paenibacillus polymyxa M1: PPM_4413Help
Entry
PPM_4413          CDS       T01968                                 

Gene name
pepC
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00620  Pyruvate metabolism
ppo00680  Methane metabolism
ppo01100  Metabolic pathways
ppo01120  Microbial metabolism in diverse environments
ppo01200  Carbon metabolism
Module
ppo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPM_4413 (pepC)
  Energy metabolism
   00680 Methane metabolism
    PPM_4413 (pepC)
Enzymes [BR:ppo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PPM_4413 (pepC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CCI71220
LinkDB All DBs
Position
complement(5123481..5126273)
Genome map
AA seq 930 aa AA seqDB search
MTELTLTANKNQSNNLLRRDVRFLGNILGEVLVHQGGNELLDIVEKIREASKSLRAGYQP
ELYENFKQMVSGLDTDIRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYEHSAGEEVQPGSI
ESSVQELKQGGFSAEDVSNMLNELSLELVMTAHPTEATRRVILDIHKRISEDVMLLDNPM
LTLREREQVRENLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETLFHVLPDVYQELE
RCLVKYYPEQKWHIPTYLRFGSWIGGDRDGNPSVTSHVTWETLRMQRKLALREYQHTLKE
LMGYLSFSTSIVRVSDDLLASIEEDRAHITLKKMEVWHNEKEPYRIKLAYMIAKVNNVLD
ESKQGTKERYSSAEELIADLNVIDNSLRHHFADYVADTYIQKMIRQVELFGFHTATLDVR
QHSQEHENAMTEILSKMKIVSDYSKLSEEEKIDLLEQLLNEPRPITSPYLKYSDSTQECL
DVYRTIYLAQEEFGKQSITSYLISMTQGASDLLEVMVLAKEVGLFRIEKDGTVICTLQSV
PLFETIDDLHAAPDIMRRLMNLPVYRQSVAAMDELQEIMLGYSDSNKDGGVVTANWELRV
AMNSITEVVNEYGAKVKFFHGRGGALGRGGMPLNRSILAQPPHTIGGGIKITEQGEVLSS
RYSLKGIAYRSLEQATSALITAAAYHRSGKKEVFEESWEEIIARISEVSLEKYQDLIFRD
PDFFSFFKESTPLPEVGELNIGSRPSKRKNSERFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSYYQNNEDNLKVLQTMFRDSAFFRSLIDTLQMAIAKADLLIAEEYAGMSDNEEARQ
RIFGQISAEFKLTSELILKITGQSEILDDVPVIQESIRLRNPYVDPLSYLQVQLLSELRE
LRNQNGDDAEMLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcttacgttaaccgctaacaaaaaccaatccaacaatctgctacggcgggac
gttcgttttctaggaaatattcttggtgaggttttggttcatcagggtggcaacgaactt
ttggatatcgtggagaaaatacgtgaggcaagtaaatcgttacgtgccgggtatcagccg
gagttatacgagaatttcaaacaaatggtcagtggactggatacggatattcgtcaccag
gttattcgcgcgtttgcgatttactttcagttggtgaatatcgctgagcagaaccatcgt
attcgtcgtaagcgggattatgagcattccgctggtgaagaggttcaacccggttctatc
gaaagttccgttcaggagcttaaacaaggaggcttctccgcagaggacgttagcaacatg
ctgaatgaactctctttggagctggtcatgactgcacatcctacagaagcaacacgacga
gtaatcctggatatccacaaacgtatttccgaagacgtcatgctgctggataatccgatg
cttaccttgcgtgagcgagaacaggtacgggaaaatctgcttaatgaagtaattacattg
tggcagaccgatgagctacgtgatcgaaagccaactgtattagatgaagtaagaaatgga
atgtattattttcatgagaccttgtttcatgtattgccggatgtataccaagaactggaa
cgatgtttggtcaaatattatcctgagcaaaaatggcacattccaacttatttgagattt
ggttcttggatcggtggagaccgagacgggaatccatctgttacatctcatgtgacttgg
gaaacattacgtatgcagcgcaagttggctttgagagaatatcagcacacgctgaaagaa
ctcatgggttacttgagcttcagtaccagcattgtgcgggtttctgatgatttgttggct
tctattgaagaagaccgcgcccacatcacacttaaaaaaatggaagtatggcataacgaa
aaagagccttatcgcatcaaactggcatatatgattgctaaggtgaataacgttttggat
gaaagcaaacagggtaccaaggagcgctacagctccgcggaggaacttattgcagacctg
aatgttattgacaacagcttgcgccatcattttgctgattatgtggcagacacgtatatc
caaaagatgattcgtcaggtagagctattcgggtttcatacggctacgctggatgtgcgt
cagcatagtcaggaacatgaaaatgcgatgactgaaattctttctaaaatgaaaattgtg
tcagattacagtaagctgtcagaggaagaaaaaatagatctgctggaacagctgctgaat
gaaccgcgtccgattacttcgccgtatctaaaatatagcgatagcacacaggaatgtctt
gatgtatatcgtacgatttatttggctcaggaggaatttggcaagcaatccattacaagc
tacttgatcagtatgacccaaggagccagtgatttgcttgaggtcatggtattagccaaa
gaggtgggcctgttccgcatcgagaaggatggcactgtcatctgtacgctgcaatccgtt
cctttgttcgaaacgatagatgatttgcacgctgcacctgatattatgagaagattgatg
aacctgcctgtatatcgacaatctgtagccgccatggatgagcttcaggagatcatgctt
ggctactcggatagtaataaggatggcggtgtggttacagcgaactgggaacttcgagtc
gctatgaatagcattacggaagtagtaaacgagtatggcgcaaaagtgaagtttttccac
ggacgtggaggagcgctggggcgtggaggaatgccacttaaccgcagtattctggctcag
cctcctcataccattggtggaggaattaagattacggagcaaggcgaagtgctatcatcc
cgctattcgctcaaggggattgcatatcggagcttggagcaggcgacatcggcgttaatt
acggctgctgcctatcatcgctcgggaaagaaagaagtgttcgaggaaagctgggaggag
attattgcccgcatttccgaggtatcactggagaagtatcaagatttgattttccgagac
ccggatttcttcagtttcttcaaagaatctacaccgttgcctgaggtaggcgagctgaat
attggatctcgcccgtccaagcgtaagaatagcgaacgttttgaggacttgcgcgccatt
ccgtgggtttttgcgtggacacaaagtcgttacttgctacccgcttggtatgcggcagga
actggtttgcaaagctactatcaaaacaatgaagataaccttaaagtgctgcaaacgatg
tttagagactctgctttcttccggtcgcttattgatacactgcaaatggcaatcgctaaa
gcggatttgctgattgcagaggagtacgctgggatgtcggataatgaagaagcacgacaa
cgtatatttggacagatttctgcagagttcaagctgacatctgagttgattttgaaaata
accggacaatccgagattttggacgatgtacctgttattcaggaatctatccggttgcgt
aatccttatgtcgatccgttaagttatttgcaggttcaattgctaagtgagctgcgcgag
ttgcgtaatcagaacggtgatgatgctgaaatgctgcgtgaggtactgttgacgattaac
ggaattgccgcaggcttgagaaacacaggctga

DBGET integrated database retrieval system