KEGG   Paenibacillus polymyxa M1: PPM_4774Help
Entry
PPM_4774          CDS       T01968                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00564  Glycerophospholipid metabolism
ppo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PPM_4774 (glpD)
Enzymes [BR:ppo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PPM_4774 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored NAD_binding_8 Pyr_redox_2 GIDA 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: CCI71581
LinkDB All DBs
Position
complement(5537887..5539593)
Genome map
AA seq 568 aa AA seqDB search
MMGEQGFAAQERTAVLERMGREHFDILIIGGGITGSGIALDAADRGLKTALVEMQDFAAG
TSSRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVFENGPHVTIPERMLLPFHQGGTFNAF
TTSIGLLVYDFLAGVKRSEHRRMLDIQTTLEREPLLKREGLRGSGSYVEYRTDDARLTIE
VMKEAVTRGALAVNYAKADKLLYDSGRISGASVTDRVTGKSYEIRASLVINAAGPWVDTL
REMDRSKEGKVLRLTKGIHLVFDAGRFPLQQAVYFDTPDGRMVFAIPRDGKTYAGTTDTV
YEGDTAHPRMTAEDRAYVLQAINGMFPDVKLTVTDVESSWAGVRPLIYEDGKSPSEISRK
DEIWESRSGLITIAGGKLTGYRKMSELVVDRAVRELGRLHGQGFRACRTRHIPISGGSVG
GSAGWDAFVSKQAIAGAALGLPPETARAWAVRYGSNVERLFAIATQSMKNATETEAALPV
EVRVPLLYAMEQEMAVTPSDFFIRRTGALFFQIDEVKRWKQAVVTLMSEHAGWSAEQERQ
YTTELDAYLYEAVTPVEIEAEPGATKVI
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgatgggagaacagggatttgctgcacaggagagaacggccgttttggagcgtatgggg
cgtgagcattttgatattttaattattggcggcggcattacagggtcgggaattgcactg
gacgcagcggatcgtggtttgaaaacggctctggtggaaatgcaggattttgcagcaggt
acatccagtcgctctaccaagctagtgcatggtggtcttcgttatttgaagcaatttgag
gtaaagatggtagccgaggtcgggaaggaacgagccatcgtattcgaaaatggtcctcat
gtgaccattccggagcgtatgctgcttccttttcaccagggtggcacatttaatgctttc
accacttctatcgggctactggtgtatgatttcctcgctggcgtgaagcgtagtgagcac
cgccgcatgctggacatccagactacgctggagcgcgagcctttgctgaagagagaagga
ctgaggggaagcggtagttatgtggagtaccgcacagacgatgctcgcctaacgattgag
gtgatgaaggaagctgttacacgaggggcgctggccgtgaactatgccaaggctgacaag
ctgctatatgacagcggacgaataagcggcgctagtgtaaccgatcgggtaacggggaag
tcatacgaaatcagggcttcgctggtcattaacgcagccggaccatgggtagatacgttg
cgggaaatggatcgctccaaagagggtaaggtgcttcgcctgacgaagggtatccacttg
gtattcgatgctgggcgcttcccgcttcaacaggcagtgtacttcgatacaccggatgga
cgcatggtattcgcgatcccgcgtgacggcaaaacctatgcaggtacgaccgatacggtg
tatgagggggatacggcgcatccccggatgaccgccgaagaccgggcgtatgtgcttcaa
gcgatcaacgggatgttcccggatgtgaagctgacggttacagacgtggaatccagttgg
gcaggggtacggccgctcatttatgaagacggtaaaagcccttcagaaatctcacgtaag
gacgaaatctgggaatcccgttcaggtctgatcacgatcgcaggcggcaagctgacaggt
taccggaaaatgtccgaactcgtcgtggatcgtgcggtacgggaattaggccgcttgcat
gggcagggctttcgggcatgccgcacaaggcatatcccaatttcgggcggcagtgtaggc
ggctcggcgggctgggacgctttcgtgagcaagcaagccatagcgggcgctgcgctcggt
ctgccgccggagaccgccagagcatgggctgttcgctatggttcaaatgtggagcgactg
tttgctatagcgacacagagcatgaagaacgccaccgagacggaagcggcactacctgtg
gaagtgcgtgttccgcttctgtacgcgatggaacaggaaatggcggtgacaccgtctgat
tttttcatacgtcgcacgggagcactgttcttccaaattgacgaggtgaagcgctggaag
caggctgtcgttacattaatgtccgagcatgcaggctggagcgccgagcaagaacgccaa
tatacgactgagctggatgcttacctgtatgaagctgtgacacctgtagagatagaagcc
gaacccggcgccactaaagtcatctga

DBGET integrated database retrieval system