KEGG   Paenibacillus polymyxa M1: PPM_4861Help
Entry
PPM_4861          CDS       T01968                                 

Gene name
amyB7
Definition
(GenBank) beta-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00500  Starch and sucrose metabolism
ppo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPM_4861 (amyB7)
Enzymes [BR:ppo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PPM_4861 (amyB7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_14 CBM_25 Alpha-amylase CBM53 Glyco_hydro_42 Cyc-maltodext_C hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: CCI71668
LinkDB All DBs
Structure
PDB: 

Position
5635194..5638784
Genome map
AA seq 1196 aa AA seqDB search
MTLYRSLWKKGCMLLLSLVLSLTAFIGSPSNTASAAVADDFQASVMGPLAKINDWGSFKK
QLQTLKNNGVYAITTDVWWGYVESAGDNQFDWSYYKTYANAVKEAGLKWVPIISTHKCGG
NVGDDCNIPLPSWLSSKGSADEMQFKDESGYANSEALSPLWSGTGKQYDELYASFAENFA
GYKSIIPKIYLSGGPSGELRYPSYYPAAGWSYPGRGKFQAYTETAKNAFRTAMNDKYGSL
DKLNAAWGTKLTSLSQINPPTDGDGFYTNGGYNSAYGKDFLSWYQSVLEKHLGVIGAAAH
KNFDSVFGVRIGAKISGLHWQMNNPAMPHGTEQAGGYYDYNRLIQKFKDADLDLTFTCLE
MSDSGTAPNYSLPSTLVDTVSSIANAKGVRLNGENALPTGGSGFQKIEEKITKFGYHGFT
LLRINNLVNNDGSPTGELSGFKQYIISKAKPDNNGGTGNKVTIYYKKGFNSPYIHYRPAG
GSWTAAPGVKMQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYSFSTGTSTY
TPGNSGNAGTITSGAPSGANPGDGGGTTNKVTVYYKKGFNSPYIHYRPAGGSWTAAPGVK
MQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYLFSTGTSTYTPGSNGAAGT
IRTGAPSGSVLSVVTSTYATDLNEVTGPIQAEKLSGVSLNVSTSTYAPNSNGVEVTAQTE
APSGAFTPMDLGTLSNPTSLNTDWSKQSIYFIMTDRFSNGDPSNDNYGGFNSNNNDQRKW
HGGDFQGIIDKLDYIKNMGFTAIWITPVTMQKSEYAYHGYHTYDFYAVDGHLGTMDKFQE
LVRKAHDKNIAVMLDVVVNHTGDFQPGNGFAKAPFDKADWYHHNGDITGGDYDSNNQWKI
ENGDVAGLDDLNHENPATANELKNWIKWLLNETGIDGLRLDTVKHVPKGFLKDFDQAANT
FTMGEIFHGDPAYVGDYTRYLDAALDFPMYYTIKDVFGHDQSMRKIKDRYSDDRYYRDAQ
TNGVFIDNHDVKRFLNDASGKPGANYDKWPQLKAALGFTLTSRGIPIIYQGTEQGYSGGD
DPANRENMNFNANHDLYQYIAKLNNVRNNHPALQNGSQKEKWVDDSFYSFQRSKNGDEAI
VFINNSWNSQTRTIGNFDNLSNGTRLTNQLSNDSVQINNGSITVTLAPKEVKIFTK
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
ttgaccttgtatcgaagtctatggaaaaaagggtgtatgcttctattaagccttgtgctg
tctctgaccgccttcattggctcaccctctaatacggcgagcgctgcggttgcagatgat
tttcaagcttccgttatgggaccgctggcgaaaatcaatgactggggttcctttaaaaag
cagctacaaacgttgaaaaacaatggcgtatatgccatcactaccgacgtctggtggggc
tatgtggagagcgcaggagataaccagttcgattggagttactacaaaacctatgcaaat
gccgtgaaagaagcgggactgaagtgggttcctatcatctcaacgcataagtgtggagga
aatgtaggagatgactgcaacatcccactgccaagctggctgtcgagcaaaggcagtgca
gatgaaatgcagttcaaggacgaaagcggctatgccaatagtgaagccctttccccattg
tggagcggaaccggtaaacaatatgacgagctgtatgcctcattcgctgaaaactttgcc
gggtataaaagtatcattcccaaaatttatttgagcggcggtccttccggggaattgcgc
tatccgtcctactatccagcagcagggtggagctacccgggacgaggcaagttccaagct
tatactgaaacagccaaaaatgcattccgcacagctatgaatgacaagtacggatcattg
gacaagcttaatgctgcttggggcaccaagcttaccagccttagccaaatcaatccaccg
accgacggggatggattttacacgaatggcgggtataattccgcgtatggaaaggatttt
ctgtcgtggtaccaaagtgtgcttgagaagcatctaggtgtcatcggagcagctgcccac
aaaaacttcgattctgtgtttggtgtccggatcggggccaaaatttccggtctgcactgg
caaatgaacaatcctgccatgccgcacggcacagaacaagcgggtggatattatgattac
aaccgtctcattcagaaattcaaggatgccgatctagacttgacatttacttgcctagag
atgagtgacagtggcacagcaccgaattattcgctgccgtccaccctggttgataccgtc
tcctccatcgcgaatgccaagggtgttcgcctgaatggtgaaaatgcacttccgacaggc
ggtagcggcttccaaaaaatcgaggagaaaatcacgaagttcggttatcacgggtttacg
ttattgcgcatcaacaatctcgtcaacaatgatggctcaccaaccggtgagttgagtgga
ttcaaacaatatatcatcagcaaagccaagcctgacaataatggcggtacaggcaacaaa
gtaacgatatactataaaaaaggcttcaactcgccttacattcactaccgtccggctggt
ggtagctggactgctgcacctggtgtgaaaatgcaggatgccgaaattagcggctatgct
aaaattaccgtcgatatcggttctgcctcccaattggaagccgcttttaacgacggcaat
aacaactgggacagcaacaacaccaaaaactactccttcagcacgggcacttctacgtac
acgcccggtaatagtggcaatgcaggaacgatcacttcaggcgctccatcgggtgcgaat
cccggggatggcggcggtacaactaacaaagtaacggtatactacaaaaaaggctttaac
tcaccttacattcactaccgtccggctggtggtagctggactgctgcacctggtgtgaaa
atgcaggatgccgaaattagcggctatgctaaaattaccgtcgatatcggttctgcctcc
caattggaagccgcttttaatgatggcaataacaactgggacagtaacaataccaaaaac
taccttttcagcactggaacttctacctacacgcccggctctaacggagccgcaggaact
atccgaacaggggcaccttccgggagcgtcctcagcgtagtgacttccacctacgcaacc
gacctcaacgaagttacaggacctatccaagcagaaaaactttcaggtgtatccttaaac
gtaagcacttctacctacgcacccaactctaacggagttgaagtaactgctcaaacggag
gcgccttcaggcgcctttacccctatggatttgggtaccctttccaaccccacttctctc
aacacagactggagcaaacagagcatttattttatcatgacagatcgtttcagcaacgga
gatccatccaacgataactacggtggcttcaattccaacaacaacgatcaacgcaagtgg
catggtggcgattttcaaggtattattgacaaactcgactacattaaaaatatgggcttt
accgcgatctggattaccccggtaacgatgcaaaagagtgaatacgcttaccacggctat
catacgtatgatttttatgcggttgacgggcatctcggaacaatggacaagttccaagag
ctggttcgcaaggcacatgacaaaaatattgctgtgatgctagacgtagtagtgaatcac
acaggtgattttcagccggggaacgggttcgccaaggctccttttgacaaagcagattgg
taccatcacaacggtgacattacagggggggactacgactccaacaaccaatggaaaatc
gaaaacggtgatgtagctggactggatgacttaaatcatgaaaaccctgctaccgccaac
gagcttaaaaactggatcaaatggctgcttaatgagacaggcatcgatggactgcggttg
gatactgtcaagcatgtaccgaagggttttctaaaggattttgaccaagccgccaatacc
ttcaccatgggtgaaattttccatggcgaccctgcttatgtgggggattacacccgatat
ctcgatgcagcactagattttccgatgtattatacaatcaaggacgtgttcggacacgat
caatccatgagaaaaatcaaggaccgctactccgatgatcgttactatcgtgatgctcag
actaacggtgtatttatcgacaatcatgatgtaaaacgtttcctgaatgacgcctctggc
aagccgggtgctaactatgacaaatggccacagctcaaagctgcattgggctttactctg
acgtcgcgtgggattccaattatctatcaaggcacagagcaaggctatagtggtggagat
gatcccgccaatcgggaaaatatgaatttcaacgccaaccatgacctgtatcagtacatc
gctaagctaaacaatgtgcgcaataaccaccctgctctgcaaaacggcagccaaaaggaa
aaatgggtggacgactccttttacagttttcagcgctctaaaaatggcgacgaggccatc
gtatttatcaacaactcctggaatagtcaaacccgcacgattggcaacttcgataatctg
tccaacggaacccgcctgactaaccagctgagcaacgactccgttcagattaacaacggt
tcgatcactgtgactcttgctccaaaggaagttaaaatcttcaccaagtaa

DBGET integrated database retrieval system