KEGG   Pectobacterium polaris: BJK05_03355Help
Entry
BJK05_03355       CDS       T05195                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppoa  Pectobacterium polaris
Pathway
ppoa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppoa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BJK05_03355
Enzymes [BR:ppoa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BJK05_03355
Transporters [BR:ppoa02000]
 Other Transporters
  Pores ion channels [TC:1]
   BJK05_03355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_4 Peptidase_MA_2
Motif
Other DBs
NCBI-ProteinID: ASY79084
LinkDB All DBs
Position
complement(770640..771284)
Genome map
AA seq 214 aa AA seqDB search
MIHVHHLEKSRSTRATWLLEELGVDYEIIRYARDPKTFSAPASLKQIHPLGKSPVITDGE
LTIAESGAIVEYLIETYGNGRLRPQSGQALLDYRFWLHFAEGSLMPLLVMRLVLAKTESA
PMPFFVRPIARKIVQSIEQAFIVPRLTTQLQFIEQHLSKQDWFAGESLSGADIQMAVPLV
LAKTRLDFSHYPHIKQYIERIESQPAFQRALAQD
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatacacgttcatcacctcgagaaatcccgttcgacccgcgcgacctggctactggaa
gagctgggcgttgattatgaaatcattcgctacgcacgtgatccaaaaacgtttagcgct
ccggcatcacttaaacaaatccacccgttagggaaatcaccggtgattaccgatggcgaa
ctgacgattgccgaatccggggccattgtggaatacctgattgagacttacggcaacggt
agactccgcccacagagcgggcaagcgctgttggattatcgcttctggctacattttgcg
gaaggttccctcatgccgctgctggtgatgcgtttagtcttggcgaaaacagaatccgcg
ccgatgccatttttcgtccgccccatcgcgcgaaaaattgtacaaagcatcgagcaggcc
tttattgtgccgcggttgacgacgcaacttcagttcatcgaacagcatttgagtaaacaa
gactggtttgcgggagaatcgctcagcggtgccgatatccaaatggccgtcccgctggtt
ttggcgaaaacgcgtttggatttcagccactacccgcacatcaagcaatacattgagcgg
atagaaagccagccagcttttcagcgggctctcgctcaggattaa

DBGET integrated database retrieval system