KEGG   Pectobacterium polaris: BJK05_05475Help
Entry
BJK05_05475       CDS       T05195                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ppoa  Pectobacterium polaris
Brite
Enzymes [BR:ppoa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BJK05_05475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ASY79480
UniProt: A0A249QGD3
LinkDB All DBs
Position
1256119..1256643
Genome map
AA seq 174 aa AA seqDB search
MKLKALILTGVFFSCSTFAADTTVTLNEALPTGAGNSIGEISITETPYGLLFTPNLKGLE
AGIHGFHVHENASCEPAEQDGKSVPALAAGGHLDPKKTGKHLGPYNDQGHLGDLPGLVVN
ADGTSTYPILAPRIKSLSEVKNHALMVHAGGDNYADMPAKLGGGGARMACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaggcacttatcctgacaggcgtgttcttttcctgttccaccttcgcggca
gataccacggtgacgctgaatgaagcgctgccaacgggagcgggaaacagcatcggggag
atatccattacggaaacgccgtacggcctgcttttcacgccgaacctgaaaggattggaa
gcggggattcacgggttccatgtgcatgaaaatgccagctgtgaacctgccgagcaagac
ggtaagtcggttcccgctctggcggcaggtggccacctcgatccgaaaaaaaccggtaaa
caccttgggccttataacgatcaggggcatttgggcgacctccccggtctggtcgtgaat
gccgatggcacatcaacctatccgattctggctcctcggataaaatcgctgtctgaagta
aaaaatcatgcgttgatggttcacgccggcggagataactacgctgacatgccagcaaaa
ctgggcggtggcggcgccagaatggcgtgtggtgtgattaagtaa

DBGET integrated database retrieval system