KEGG   Pectobacterium polaris: BJK05_06675Help
Entry
BJK05_06675       CDS       T05195                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
ppoa  Pectobacterium polaris
Pathway
ppoa00040  Pentose and glucuronate interconversions
ppoa00051  Fructose and mannose metabolism
ppoa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BJK05_06675
   00051 Fructose and mannose metabolism
    BJK05_06675
Enzymes [BR:ppoa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BJK05_06675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ASY79700
UniProt: A0A249QJC8
LinkDB All DBs
Position
complement(1556390..1557388)
Genome map
AA seq 332 aa AA seqDB search
MATYNYPEFGAGLWHFANYIDRYAVDGYGPALSTIDQIKAAKEVGELSYVDLPYPFTPGV
TLSEVKDALKDAGLKAIGITPEIYLQKWSRGAFTNPDPAARAAAFELMHESAGIVRELGA
NYVKVWPGQDGWDYPFQVSHKNLWKLAVDGMRDLAGANPDVKFAIEYKPREPRVKMTWDS
AARTLLGIEDIGLDNVGVLLDFGHALYGGESPADSAQLIIDRGRLFGMDVNDNLRGWDDD
LVVGTVHMTEIFEFFYVLKINNWQGVWQLDQFPFRENHVEAAQLSIRFLKHIYRALDKLD
IPALQAAQEAQNPLQAQRIVQDALLSSINVDE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtataactaccctgaatttggtgccggtttgtggcattttgcgaactatatc
gaccgctatgccgtagatggctatggcccggcattgagcacgatcgatcagatcaaagcg
gcgaaagaggtcggcgaactttcctatgtcgacttgccttatcccttcacgccgggcgtg
acgctcagcgaagtgaaagatgcactgaaagatgcgggactgaaagcgattggcatcacg
ccggagatttacctgcaaaaatggtcgcgtggtgcctttaccaaccccgatccagcagcc
cgagcggcggcgttcgaattaatgcacgaatctgcgggcattgtgcgtgaacttggcgcg
aattacgtcaaagtctggccgggtcaggatggctgggattatccgtttcaggtcagccat
aaaaacctgtggaagctggcggttgacggcatgcgcgatctagcaggggctaaccccgat
gtgaaattcgctattgaatacaaaccgcgtgaaccgcgcgtgaaaatgacctgggattct
gccgcgcgaacgctgctgggcatcgaagatatcgggctggataacgtaggcgtgctgctg
gactttgggcatgcgctgtatggcggcgaatcaccggctgattctgcccagttgattatc
gatcgtggtcgtctgttcggtatggatgtgaacgataacctgcgcggctgggatgacgat
ctggtggtcggcacggtgcatatgaccgagatcttcgaattcttctacgtgctgaaaatc
aacaactggcagggcgtctggcagctcgatcagttcccgttccgtgagaaccacgttgag
gcggcgcagctgtctattcgtttcctgaagcacatctatcgcgcgctggataagctggat
atcccggcgcttcaggcggcgcaggaagcacaaaatccgttacaggcgcagcggattgtg
caggatgcgctgctgtcatccattaacgttgacgagtaa

DBGET integrated database retrieval system