KEGG   Pectobacterium polaris: BJK05_14130Help
Entry
BJK05_14130       CDS       T05195                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ppoa  Pectobacterium polaris
Brite
KEGG Orthology (KO) [BR:ppoa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ppoa03012]
    BJK05_14130
   03029 Mitochondrial biogenesis [BR:ppoa03029]
    BJK05_14130
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppoa04147]
    BJK05_14130
Translation factors [BR:ppoa03012]
 Eukaryotic Type
  Elongation factors
   BJK05_14130
 Prokaryotic Type
   BJK05_14130
Mitochondrial biogenesis [BR:ppoa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BJK05_14130
Exosome [BR:ppoa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BJK05_14130
  Exosomal proteins of breast cancer cells
   BJK05_14130
  Exosomal proteins of colorectal cancer cells
   BJK05_14130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ASY81063
UniProt: A0A249Q9K5
LinkDB All DBs
Position
complement(3211575..3212759)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVVRGSALKALE
GEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccccacgttaacgtcggtactatcggccac
gttgaccatggtaaaactactctgaccgctgcaatcactaccgttctggctaaaacctac
ggtggtaacgcgcgtgcattcgaccagatcgataacgcaccggaagaaaaagcacgtggt
atcaccatcaacacttctcacgttgaatacgataccccgtctcgccactatgcgcacgtt
gactgcccaggacacgccgactatgtgaaaaacatgatcaccggtgctgctcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccaatgcctcagacccgtgagcacatc
ctgctgggtcgtcaggttggcgttcctttcatcatcgtgttcctgaacaaatgtgacatg
gttgatgacgaagagctgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgacttcccaggcgacgacaccccagtggtgcgtggttctgctctgaaagcgctggaa
ggcgaagctgagtgggaagcaaaaatcatcgaactggcaggctacctggattcttatatt
ccagaaccagagcgtgcgattgacaagccgttcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtactgttgttaccggtcgtgtagagcgcggtatcgttaaagttggt
gaagaagttgaaatcgttggtatcaaagatactgcgaaatctacctgtaccggcgtagaa
atgttccgcaaactgctggacgaaggtcgtgcaggcgagaacgttggtgttctgctgcgt
ggtatcaagcgtgaagaaatcgagcgtggtcaggtactggctaagccgggttcaatcaag
ccgcacactcagttcgaatcagaagtgtatatcctgagcaaagatgaaggcggccgtcat
actccgttcttcaaaggctaccgtcctcagttctacttccgtacaactgacgtaacgggc
accatcgaactgccagaaggcgtagagatggttatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccaatcgcgatggatgacggtttgcgtttcgcaatccgtgaaggc
ggccgtacagtaggcgcgggcgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system