KEGG   Pectobacterium polaris: BJK05_14655Help
Entry
BJK05_14655       CDS       T05195                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ppoa  Pectobacterium polaris
Pathway
ppoa00564  Glycerophospholipid metabolism
ppoa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppoa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BJK05_14655
Enzymes [BR:ppoa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BJK05_14655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 NAD_binding_8 FAD_binding_3 3HCDH_N FAD_oxidored GIDA HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ASY81160
UniProt: A0A093SLN2
LinkDB All DBs
Position
3332719..3334218
Genome map
AA seq 499 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALSERETLLKMAPHIIFPMRFRLPHQPHLRPAWMIRIGLFMYDNIGKRVSLPAS
KGLKFGADSVLKPELKQGFEYSDCWVDDARLVVLNAQEVTKRGGEVRTRTKVTRARREQG
VWIVDAVDSLTGETFTWRAKGLVNATGPWVKEFFDDGLQLKSPYGIRLIKGSHIVVPKVH
NQPQAYILQNKDHRIVFVIPWQDDYSIIGTTDVEYKGNPHDVKIDDNEVAYLLDVYNDHF
KQQLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLSVDDDNGQAPLLSVFGGKLTTYRK
LAEHALDKLHKYYPQAGKAWTKGAVLPGGDIAGTRDDYAAALRRRFNLPESLTRRYSRTY
GSNSELILANVKGLSDLGEDFGHDLYEAELRYLVEKEWAVMLDDVIWRRTKLGMRFDDAQ
KQRISDWLANHYQQIAKAG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctaatcgttatcggcggcggaattaacggtgcaggcatcgccgca
gatgcggctgggcgagggttatcagtcctgttgttggaagcgcaggatcttgcctgtgcc
acgtcctccgccagttccaagctgattcacggtggcctgcgttaccttgagcactatgag
tttcgtttggtcagcgaagcgctgtctgagcgcgaaacgctgctgaaaatggccccgcac
attattttccctatgcgctttcgtttgccccatcagccgcacctgcgtccggcctggatg
attcgtatcggcttgttcatgtacgacaacatcggcaaacgcgtcagcctgcctgccagt
aaaggcctgaaattcggcgcagattctgtgcttaagcctgaattgaagcagggctttgaa
tattctgactgctgggtggacgatgcgcgtctggtggtgttaaacgcgcaggaagtgaca
aaacgcggcggagaagtccgtacccgcaccaaagtgacccgcgctcgccgtgagcaaggc
gtgtggattgtggatgcggttgattcattgaccggagaaaccttcacctggcgcgccaaa
ggtctggtgaacgccactggcccgtgggtgaaagaattctttgatgacggcctgcaactg
aaatcgccttacggcatccgtttgatcaaaggcagccacatcgtggtgccaaaagtccat
aaccagccgcaggcgtatattctgcaaaacaaagatcaccgtattgtgttcgtgatcccg
tggcaggatgactactcaatcatcggcacgaccgacgtggagtacaaaggcaatccgcac
gatgtgaagatcgatgacaacgaagtcgcctacctgctggacgtgtataacgaccatttc
aaacagcagcttacgcgtgacgatatcgtctggacttactctggcgtgcgcccgctgtgt
gatgacgagtccgattctccgcaggcgattacccgtgactacacgctgtcggtcgatgat
gataacggtcaggccccgctgctttctgtgtttggtggcaagctgacgacataccgtaag
ctggcagagcacgcgctggataagctgcacaaatactacccgcaagcgggtaaagcctgg
acgaaaggtgcggtactgccgggtggtgatatcgcgggcacgcgtgatgactacgccgcc
gcgctgcgtcgccgcttcaatctgcctgaatcactgacacgccgttacagccgcacctac
ggttcaaacagcgaactgattctggcaaacgtgaaaggcctcagcgatctgggtgaagat
ttcggtcatgacctgtatgaagcggaactgcgctatctggtcgaaaaagaatgggccgtt
atgcttgatgacgtcatctggcgccgcaccaaactgggtatgcgcttcgatgatgcacag
aaacaacgcatcagcgactggctggcaaaccattaccagcagatagcaaaagcgggctaa

DBGET integrated database retrieval system