KEGG   Pectobacterium polaris: BJK05_17000Help
Entry
BJK05_17000       CDS       T05195                                 

Definition
(GenBank) sufurtransferase FdhD
  KO
K02379  FdhD protein
Organism
ppoa  Pectobacterium polaris
Brite
KEGG Orthology (KO) [BR:ppoa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    BJK05_17000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FdhD-NarQ
Motif
Other DBs
NCBI-ProteinID: ASY81593
LinkDB All DBs
Position
complement(3881464..3882297)
Genome map
AA seq 277 aa AA seqDB search
MQVFQVEGVHLPADAALEGATQHSVYHPDSLHQPQSDWLAEEVPVALVYNGISHVVMMAS
PKELEEFALGFSLSEGIIQSPADIYGIDVQTACNGIEVQIELSSRRFAGLKERRRAMDGR
TGCGVCGVEQLAEIGKPIAPLPFTQTFSISKLENALVRLRDVQKIGQVTGCTHAASWVAP
DGTLSGGSEDVGRHVALDKLLGTRAKQGWQQGAALVSSRASYEMVQKSAMCGVEILFAVS
AATSLAVEVAQRCNLTLVGFCRPGHATIYTHPQRLSM
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtatttcaggtggaaggggttcatttaccagcggatgccgcccttgaaggcgca
acgcaacattcagtctatcatcccgattcgctgcatcagccacagtctgactggctggcg
gaagaggtgcccgttgcgttggtttataacggtatatcgcatgtcgttatgatggcctca
ccgaaggaactggaggagttcgctctcgggttttccttatctgaaggcattattcaatca
ccggctgatatctacggcattgatgtacagaccgcctgtaacggcatcgaagtacagatt
gagctttcgagccgacgcttcgctgggctaaaagaacgccgccgggcgatggatggccgc
acaggctgcggcgtatgtggcgtagagcaacttgcggaaatcggcaaaccgatcgcacct
ctgcccttcacacagacattttccattagcaaacttgaaaatgcgctggtgcgtctgcgc
gatgtgcagaagatcggtcaagtgacgggttgcacccacgccgcaagctgggtcgcgcca
gacggcacgctgtccggggggagtgaggacgtcggccgccatgtcgcgctggataaactg
ctgggtacccgagcaaaacaggggtggcagcaaggcgcagcgctggtttccagccgggcc
agctatgagatggtccaaaaatccgccatgtgtggcgtggaaatcctgtttgctgtctca
gcggcaacctcgctggccgtagaggtcgcacagcgttgcaacctgacgctggtcggtttt
tgtcggccgggacatgcgactatctacacacatccgcagcgtctgagcatgtaa

DBGET integrated database retrieval system