KEGG   Paenibacillus polymyxa CR1: X809_01490Help
Entry
X809_01490        CDS       T02956                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
ppol03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppol00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    X809_01490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppol03400]
    X809_01490
Enzymes [BR:ppol01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     X809_01490
DNA repair and recombination proteins [BR:ppol03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     X809_01490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AHC18027
LinkDB All DBs
Position
complement(324820..325782)
Genome map
AA seq 320 aa AA seqDB search
MRTEIKPVIPFEPELSEKVPVDPGLWRYEIKWDGTRIMTYHDQGGTRLFNRKQHERTLLY
PELALFPSYCKADSVIMDGEMIALGADGKPSFHEIMRRDLIRRTDRVQSAYEAVPATYML
FDIVYLNGEWVHLKPLQERLELLHQIIIPNERIQLAPAHPDGQALFQVMCSQGMEGIVCK
KLDSPYTLGGKDGRWLKVKNYGDIIAVIGGYTLNGGIINAVLLGQYDKQGMLRYIGHVGT
GKLTREDWRQLTERLLPHIISERPFSNKPDRHQDAFWVKPMYTAKVQYSEWRWQEGRTLR
QPSIQAFVNQGPDQCIGPWM
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtacagaaataaaacctgtcatcccgtttgagccggaactgagcgaaaaagtacct
gtagatccgggcctttggcgttacgaaataaaatgggacggtacgagaattatgacgtat
cacgaccagggcggtacgcgtctgttcaaccgcaagcagcatgaacgaacgcttttatac
ccggagcttgctctctttccctcctactgtaaggctgattcggtcataatggacggggaa
atgatcgcactcggtgccgacggtaagccatcgttccatgaaattatgcgacgggatctg
attcgtcggacggatcgagttcagtcagcctatgaagctgtacccgctacttacatgttg
tttgatattgtttatctgaacggggagtgggttcatcttaaaccgttacaggaaaggctt
gaactgctgcatcagatcatcataccgaatgaacggattcaactggctcccgctcatcct
gatggacaagctctatttcaggttatgtgcagccaaggaatggaaggcattgtgtgtaaa
aagctggatagtccgtacacattgggcggaaaggacggacgatggctcaaggtcaaaaat
tatggcgatattattgccgttatcggtggctataccctaaacggaggcattatcaatgct
gtgttgctgggccaatatgataaacaaggaatgctgcgctatatcgggcatgtggggacg
ggtaagctgactcgggaagattggcgtcagcttaccgagcgcctgctaccacatatcata
tcggagcgaccttttagcaataaaccggatcggcatcaagacgcattttgggtgaaaccc
atgtataccgccaaggttcaatatagtgaatggcggtggcaagaaggacgtaccctgcgt
cagccctccatacaagcctttgtgaatcagggccccgatcagtgtatcggcccctggatg
tga

DBGET integrated database retrieval system