KEGG   Paenibacillus polymyxa CR1: X809_06760Help
Entry
X809_06760        CDS       T02956                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
ppol00473  D-Alanine metabolism
ppol01100  Metabolic pathways
ppol01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    X809_06760
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    X809_06760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppol01011]
    X809_06760
Enzymes [BR:ppol01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     X809_06760
Peptidoglycan biosynthesis and degradation proteins [BR:ppol01011]
 Precursor biosynthesis
  Racemase
   X809_06760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: AHC18942
LinkDB All DBs
Position
1463834..1465030
Genome map
AA seq 398 aa AA seqDB search
MQAQYRSTRAEINLDHLGANYEAFRKALPADKLILVCVKANAYGHGAVEISKELERLGAD
YLSVAFLDEALELRHAGVQLPILVLGYTSPEAVQTAWEHDISLTVFSDEVLEGIRRLDRQ
GNERKLKVHIKIDSGMGRLGLLPGEEAMAFVRQAHKLEQVLLEGMYTHFARADEEDKSYT
LLQYDRFRGVAEALREQGITIPIIHTGNSAATIDTPSLSPNMVRIGISIYGLYPSDEVNR
QAIELLPVLSLKTAVVYTKTLPPGWGVSYGTRYVTSSEERIGTLPIGYADGYSRMLSGKI
EVLIRGRRVPVLGTICMDQCMVSLQSFAEDAEEIQTGEEVVLIGQQSGETIAADELASKL
GTIHYEVICMIADRVPRVYTRGHVPVVRVNSLLPTRWN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagcacaatacagatcgacccgggccgaaatcaacctggatcaccttggcgccaac
tatgaagcttttcgcaaggcattaccagcggataagctgatactggtctgtgtcaaggct
aatgcctacggacacggtgccgtggaaatttcaaaggaattggaacgccttggtgcggat
tatttgagcgtcgcttttctggatgaagcgttggagcttcgtcatgcgggggttcagcta
ccgattcttgtactcggctatacctcaccggaagctgtacaaacggcttgggagcatgat
atctcattgactgtgttcagtgatgaagtgctggagggtatccgcagactggaccgccaa
ggaaacgaacgcaagctgaaggtgcacatcaaaatagacagcggcatgggaagactgggt
ttgctgcctggagaagaggctatggcttttgtccggcaggctcacaaattagagcaggtg
ctgctggaaggcatgtacacccattttgcccgcgcggatgaagaagacaaaagctataca
ctgctacaatatgatcggtttcggggcgtggcggaagcgctaagggaacaaggtatcacc
attcccattatacatacgggcaatagcgccgccaccattgataccccttctctttccccc
aatatggtgcggattggtatcagtatatacggtctgtatccgtctgatgaggttaatcgg
caagccattgagctgctgcctgtattgtcattgaagacggcggtggtttacaccaaaacg
cttcctcccggctggggagttagttatggcacccggtatgtaacctccagtgaagaacgg
atcggtacactgccaatcggctatgcggatggatactcccgcatgctgagtgggaagatc
gaagtgttgatacgcggtcgccgcgtcccggtactcggtacgatttgcatggaccagtgt
atggtatccttacaatctttcgcagaagatgcggaagaaatccaaaccggcgaagaggtt
gttctcatcggccagcagtccggcgaaactatcgcggcggatgagttggcatccaagctt
ggtacgatccactatgaggtgatctgcatgatcgcagatagggtaccgcgtgtatacaca
cgaggtcatgttcctgttgttcgagtgaactcgcttcttccaacccgctggaattaa

DBGET integrated database retrieval system