KEGG   Paenibacillus polymyxa CR1: X809_08640Help
Entry
X809_08640        CDS       T02956                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
ppol00020  Citrate cycle (TCA cycle)
ppol00480  Glutathione metabolism
ppol01100  Metabolic pathways
ppol01110  Biosynthesis of secondary metabolites
ppol01120  Microbial metabolism in diverse environments
ppol01130  Biosynthesis of antibiotics
ppol01200  Carbon metabolism
ppol01210  2-Oxocarboxylic acid metabolism
ppol01230  Biosynthesis of amino acids
Module
ppol_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppol_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ppol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    X809_08640
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    X809_08640
Enzymes [BR:ppol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     X809_08640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AHC19286
LinkDB All DBs
Position
1846715..1848010
Genome map
AA seq 431 aa AA seqDB search
MAKFEKFELPTEGEKITIDNGQLQVPNHPVIPFIEGDGTGRDIWKASKRVLDAAVEKAYN
GSKKIAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFNGVPSPVKRPELVDMVIFRENTEDIYAGIEYAEGSEDVKKVIQFLQ
QELGVNKIRFPETSGIGIKPVSSEGSKRLVRAAIQYAVDHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEEEFADKVFTWAQYDVIKEKDGEDAANAAQKAAEDAGKIIIKDAIADIALQ
QVLTRPSEFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWQEAADLIYKGLETSINKKIVTYDFARLMDGATQVKC
SEFADTIISNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatttgaaaagtttgagctcccaactgaaggcgaaaaaattacgattgataac
ggtcaactacaggttccgaaccatccggtaattccgtttatcgaaggtgacggcacgggt
cgcgacatctggaaagcttccaaacgcgtactggacgcagctgtagaaaaagcatataac
ggcagcaaaaagattgcctggtatgaagtattcgctggtgagaaagctttcaatacatac
ggcgaatggctccctaacgatactttggaagccatccgtgagtatattgtagccatcaaa
ggaccacttacgacacctattggcggtggtatccgttcgttgaatgtggcattgcgtcaa
gaactggatttatacgtatgtctgcgtcctgttcgttattttaacggtgttccttctcca
gtgaaacgtcctgaattggtagacatggttattttccgtgagaacacagaagatatttac
gcggggatcgagtatgctgaagggtccgaagacgtgaaaaaggttattcagttcctccaa
caagagctgggtgtgaacaaaatccgtttccctgaaacctctggtattggcattaagcca
gtttcttccgagggttcaaagcgtctggtgcgggctgccattcagtatgctgttgaccac
ggacgcaagagtgtaacgctcgtacacaaaggtaacattatgaaatttaccgagggtgcc
ttcaaaaactggggttatgaagtggctgaggaagaatttgcagataaagtatttacttgg
gcccaatatgatgtaatcaaggaaaaagacggtgaggatgcggcgaatgcagctcaaaaa
gcagctgaagatgcaggcaaaatcattatcaaggatgcgattgctgatattgcacttcag
caagtactgactcgtccttctgaatttgatgtgattgctacgctcaacctgaacggggac
tatctgtccgatgctcttgctgcccaagttggtggaattggtattgcgccaggtgcgaac
attaactatgtaacagggcatgctatctttgaagctacacatggtacagctccaaaatac
gccgacaaagacgtagtgaaccctggttccgtaattctgtcgggcgtaatgttgcttgaa
cacttgggttggcaagaagcggctgacctgatttacaaagggctggagacgtccattaat
aagaagattgtaacttatgactttgctcgtctgatggatggtgctacacaagtgaaatgc
tccgagttcgcagataccattattagtaacctgtaa

DBGET integrated database retrieval system