KEGG   Paenibacillus polymyxa CR1: X809_31800Help
Entry
X809_31800        CDS       T02956                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ppol  Paenibacillus polymyxa CR1
Brite
KEGG Orthology (KO) [BR:ppol00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppol01001]
    X809_31800
Enzymes [BR:ppol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     X809_31800
Protein kinases [BR:ppol01001]
 Serine/threonine kinases: Other
  Bacterial family
   X809_31800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Haspin_kinase RIO1 Kdo FTA2 YrbL-PhoP_reg Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AIW40612
LinkDB All DBs
Position
complement(3631802..3634072)
Genome map
AA seq 756 aa AA seqDB search
MIGHLLGGRYEIIERIGGGGMALVYKAQDILLNRNVAVKVLRQQFVHDEEFIRRFRREAQ
SAASLSHSNVVSIYDVGQEDEIHYIVMECIEGKNLNEIIKERAPLQVDEAVRIASQICDA
LEHAHQNQIIHRDIKPHNILIGRNGRVKVTDFGIARAVTSTTITQTGSVVGSVHYFSPEH
AKGVVTGEKSDLYSLGIVLYQMLTAQLPFLGESPISVALKHLQEEFEEPRKINPLIPQSV
ENVILKSMRKNPEERYQSADEMLKDLETCLLPGRRNESKLEFTHLDDEDQTRVIPAIKPQ
QLGMSSSGDDVPAQPRESEQLSSKQSSKKNRKKAILWVTLVLVLLLCMGGVVYYVQSVLV
VPEVKVPGVLTQTEDQAKVNLSKAGLLIEEPIQHEYKEGIAPGVVFYQSYPADSLVKEGT
KISLKVGIAKPLTPMPDVKGQSYENAVKLLTAQQIKETQIQQNEQFSDQAAGTVLSQTPA
ANEPFDKDSVQVVLTVSKGADTVKMPSLVGKTQNQAENEVKKAGLKVGSIKEEFSYEQEK
GRVTKQWPSEAGSELPPNTEITFYVSTGYPPEAITLPFNVPVAPKEEGKNSKIRITYTDA
RGENQEWGSRTINTTQMFTINLLMAPNKDSVVSVFRDGDFIDTYPVSYIEAKNGTVTMPQ
IAPPAGTSPTDTPDGTSSQNGSGNGEEGDSGGSSNDTGNSGGDSNNQEGTGGNGDPSAFV
PGTNSTGSTRSELAVSHKNNPGHAKKEKVIEAVQHQ
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggcacctgctagggggaagatacgaaattattgagcgtatcggtggcggcggt
atggcgctggtgtataaggctcaagacattttgctgaatcgcaatgtcgcagttaaagtg
ttgcgccagcaatttgttcatgatgaggaatttattcgccgatttcggcgtgaggcgcag
tctgcggcctcgctttcgcattcgaatgtggtcagtatttatgatgtcggccaagaggat
gaaatccattatattgtaatggagtgcatcgaaggtaaaaatttgaatgagattattaaa
gaacgtgcaccattgcaagtggatgaagcagtacggattgcttcccagatttgtgatgcg
ctggagcatgcccaccaaaatcagatcattcaccgagacattaagcctcataatatatta
attggacgtaatggacgggttaaggtaactgattttgggattgctagagctgttacgtca
acgaccattacccagacgggttctgttgtgggttctgttcattatttttcacctgagcat
gcaaagggtgtcgtcaccggcgaaaaatcggacttatattctttaggtattgtcttatat
caaatgctgacagcgcagctccctttcctgggagaaagtccaattagtgtagcgctcaag
cacttgcaagaggaatttgaggaaccacgtaaaattaatccgttgattccgcaaagtgtg
gaaaatgtcattctaaaatccatgcgcaaaaatccagaagagcgttatcaatcggcagac
gaaatgctaaaagatctagaaacctgtttgctgccgggacggcgtaatgaatccaagctg
gagtttacacatttggatgatgaggatcaaacacgggttattccggctataaagcctcaa
caattagggatgtcttctagtggcgatgatgtacctgctcaaccgcgtgagtctgaacag
ctttcgagcaagcaatcgtccaaaaaaaatagaaaaaaagcgatcttgtgggtaacacta
gtgttggtgttacttctgtgcatgggcggagtggtgtactatgtgcaaagtgtacttgtc
gtgcctgaggtaaaagtaccaggtgtattgacacaaacagaagaccaagcgaaggttaat
ctcagtaaagcgggattactcattgaggagccaatccaacatgaatacaaagagggaatc
gcgcctggagttgtattttatcaaagctatcctgcagattctttagtcaaggaaggaacc
aagattagtctgaaagtcgggattgccaagccgctcaccccgatgcctgatgtcaaaggc
caaagctacgagaatgctgttaagctgctgaccgcccagcaaattaaggagacgcagatt
cagcaaaatgagcagttcagtgatcaggccgcggggaccgtccttagtcagacacccgct
gcaaatgagccatttgataaggactcagtccaggttgtgctcacagtcagcaagggcgct
gatactgtgaaaatgccaagcctggtagggaagacgcagaaccaagcagaaaatgaggtt
aaaaaggcagggctgaaagttggctcgattaaagaagaatttagctatgagcaggaaaaa
ggaagagtaaccaaacagtggccgtcagaggcaggcagtgagttgccaccaaatacggaa
attacgttttatgtaagcacgggttacccgccagaagctattacactaccatttaatgtg
cctgttgcgccgaaggaagagggcaaaaacagcaaaattcgtatcacttatacggatgcg
cgtggagaaaatcaggaatggggaagccgtacgattaatacgacacagatgttcactatc
aatctgctaatggctccgaacaaagacagtgttgtctcagtatttagagatggtgacttt
attgatacgtatccagtctcttatattgaggcgaaaaatggaacggtgacgatgccccaa
attgctccgcctgctggaacttcaccaacggatacacctgatggtacttcctcgcagaat
ggaagtggaaacggcgaggaaggtgatagcgggggatcttctaatgatactggcaatagt
ggaggtgactcgaacaatcaggagggcacaggaggtaatggtgacccttccgcctttgtt
cctggaacgaattccacggggagtacgcgcagtgagttggcggttagtcataaaaacaac
ccaggccacgcaaagaaggaaaaagtgattgaggctgttcagcatcagtaa

DBGET integrated database retrieval system