KEGG   Paenibacillus polymyxa CR1: X809_36325Help
Entry
X809_36325        CDS       T02956                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
ppol  Paenibacillus polymyxa CR1
Brite
KEGG Orthology (KO) [BR:ppol00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ppol01002]
    X809_36325
Enzymes [BR:ppol01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     X809_36325
Peptidases [BR:ppol01002]
 Metallo Peptidases
  Family M4: thermolysin family
   X809_36325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP
Motif
Other DBs
NCBI-ProteinID: AIW41409
LinkDB All DBs
Structure
PDB: 

Position
4711441..4713219
Genome map
AA seq 592 aa AA seqDB search
MKKVWVSLLGGAMLLGSVASGASAESSVSGPTQLTPTFHAEQWKAPSSVSGDDIVWSYLN
RQKKSLLGADDSSVREQFRIVDRTSDKSGVSHYRLKQYVNGIPVYGAEQTIHVGKSGEVT
SYLGAVVTEDQQAEATQGTTPKISASEAVYTAYKEAAARIEALPTSDDTISKDVEEQSSV
SKDTYAEAANNEKTLSTDKDELSLDKASALKDSKIEAVEAEKSSIAKIANLQPEVDPKAD
LYFYPKGDDLQLVYVTEVNVLEPAPLRTRYIIDANDGSIVFQYDIINEATGTGKGVLGDT
KSFTTTASGSSYQLKDTTRGNGVVTYTASNRQSIPGTILTDADNVWNDPAGVDAHTYAAK
TYDYYKAKFGRNSIDGRGLQLRSTVHYGSRYNNAFWNGSQMTYGDGDGSTFIAFSGDPDV
VGHELTHGVTEYTSNLEYYGESGALNEAFSDVIGNDIQRKNWLVGDDIYTPNIAGDALRS
MSNPTLYDQPDHYSNLYTGSSDNGGVHTNSGIINKAYYLLAQGGTFHGVTVNGIGRDAAV
QIYYSAFTNYLTSSSDFSNARAAVIQAAKDQYGANSAEATAAAKSFDAVGVN
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtatgggtttcgcttcttggaggagctatgttattagggtctgtcgcgtct
ggtgcatcagcggagagttccgtttcggggccaactcagcttacaccgacctttcacgcc
gagcaatggaaagccccttcctcggtatcgggggacgacattgtatggagctatttgaat
cggcaaaagaaatcgttactgggtgcggacgactctagtgtacgtgaacaattccgaatc
gttgatcgcacaagcgacaagtccggtgtgagccattatcggctgaaacagtatgtaaac
gggattcccgtatatggagctgaacagactattcatgtgggcaaatctggtgaggtcacc
tcttacttaggagcggtggttactgaggatcagcaagctgaagctacgcaaggtacaact
ccaaaaatcagcgcttctgaagcggtctacactgcatataaagaagcagctgcacggatt
gaagccctccctacctccgacgatacgatttctaaagatgttgaggaacaaagcagtgta
agcaaagacacttacgccgaagcagctaacaacgaaaaaacgctatctactgataaggac
gagctgagtcttgataaagcatctgccctgaaagatagcaaaattgaagcggtggaagca
gaaaaaagttccattgccaaaatcgctaatctgcagccagaagtagatcctaaagccgat
ctgtacttctatcctaaaggggatgacctgcagctggtttatgtaacagaagtcaatgtt
ttagaacctgccccactgcgtactcgctacattattgatgccaatgatggcagcatcgta
ttccagtatgacatcattaatgaagcgacaggcacaggtaaaggtgtgcttggtgatacc
aaatcattcaccacaactgcttccggcagtagctaccagttaaaagatacaacacgcggt
aacggggttgtgacctacacggcctccaaccgtcaaagcatcccaggtaccattctgacc
gatgccgataatgtatggaatgatccagccggcgtggatgcccatacgtatgctgccaaa
acatatgattactataaggccaaatttggacgcaacagcattgacggacgcgggctgcaa
ctccgttcgacagtccattacggtagccgttacaacaacgccttctggaatggctcccaa
atgacttatggagacggggacggtagcacatttatcgcattcagcggggaccccgatgtg
gtaggtcatgaacttacacacggtgtcacagagtatacttcgaatttggaatattacgga
gagtccggtgcattgaatgaggctttctcggacgtcatcggtaatgacattcagcgtaaa
aattggcttgtaggcgatgatatttatacgccaaacattgcaggcgatgctctgcgctct
atgtccaatcctaccctgtacgatcaaccagatcactattccaacttgtatacaggcagc
tccgataacggcggcgttcatacgaacagcggtattatcaataaagcctactatctgtta
gcacaaggtggtactttccatggcgtaactgtaaatggaattggccgcgatgcagcggtt
caaatttactatagtgcctttacgaactacctgacttcttcttccgacttctccaacgca
cgcgctgctgtgatccaagcagcaaaagatcagtacggtgcgaactcagcagaagcaact
gcagctgccaaatcttttgacgctgtaggcgtaaactaa

DBGET integrated database retrieval system