KEGG   Paenibacillus polymyxa CR1: X809_40800Help
Entry
X809_40800        CDS       T02956                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
ppol00500  Starch and sucrose metabolism
ppol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    X809_40800
Enzymes [BR:ppol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     X809_40800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AIW42189
LinkDB All DBs
Position
5713421..5714914
Genome map
AA seq 497 aa AA seqDB search
MKRNHTMMQFFEWNVEADGSHWKKLTRLAPELKAKGIDAIWIPPVTKGQSPEDTGYGVYD
LYDLGEFDQKGAVRTKYGTREDLLEAVAACVRHGVAVYVDLVMNHKAGADETEVFKVVEV
NPDNRNEVISEPFDIEGWTKFTFPGRQGQYSTFQWNFEHFNGTDYDASQDRTGIYRILGK
NKSWSENVDDEFGNYDYLMFANIDYNHQDVRKEMIRWGKWLVDTLQCNGFRLDAIKHINH
EFVREFATEMIKKRGQDFYMVGEFWKPDLESCQKFLDTIDYKIDLFDVSLHYKLHSASLG
GKDFDLSTIFEDTLVHTHPLNSVTFVDNHDSQPHEALESWVEDWFKPSAYALILLRKDGY
PCVFYGDYYGIQGQTPVKGKQAELDPLLYARYHKAYGEQKDYFDDPHTIGWVRQGVPELE
GSGCAVVITNANDGEKRMFVGKQHAAEEWIDLTGRHDHTVKIEQDGYGIFPVRAGSVSVW
ALPAEEDSQETEEEANA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaccatacgatgatgcaatttttcgagtggaatgtcgaagctgacggttct
cactggaagaagcttacccgcctggcgccggaactgaaagccaaaggaattgacgcgata
tggattccacctgtcaccaaaggccaatcgcccgaggatacgggatacggcgtctatgac
ctttatgatctgggcgaatttgaccaaaaaggtgcggtgcgcaccaaatacggaaccagg
gaagacctgctggaggctgttgccgcctgcgttcgccacggtgtggccgtctatgtcgat
ctggttatgaaccataaggctggcgcggatgaaaccgaagtgttcaaggtcgtcgaggtc
aatccggataaccgcaatgaggtcatttccgagccctttgatatcgagggctggactaaa
tttacgttccccggccgtcaaggtcagtattccacatttcaatggaactttgaacatttt
aacggaaccgattacgatgcaagccaggaccggacaggaatctatcgtattttaggtaaa
aataaaagctggagcgaaaatgtagatgatgaattcggcaattatgattatttaatgttc
gccaatattgattataatcatcaggatgtgcgcaaagagatgatccgctggggcaaatgg
ctggtagatactctgcaatgcaacggattccgtctggatgcaatcaagcatattaatcat
gaatttgtacgagagtttgctacagaaatgattaaaaaacgcggacaggatttttatatg
gtaggcgagttttggaaaccggatctggaatcgtgtcaaaagttcctggataccattgat
tataaaatcgacctatttgacgtatccctccactacaaactacatagcgcttccttgggt
ggcaaggatttcgatttaagcaccattttcgaggatacgcttgttcatacccatcccctg
aactcggttacttttgtcgataatcatgattcccagccgcatgaagcgcttgaatcctgg
gtggaggactggttcaagcccagcgcctatgcacttatcttgctgcgcaaggacggttat
ccctgcgtattctatggcgattactacggcatccagggacaaacgcccgtcaaaggcaag
caggctgagctagacccgcttctatatgcccgataccataaagcttatggtgagcaaaaa
gattatttcgatgatccccatacgattggatgggttcgtcaaggcgtgcctgagctggaa
ggctccggatgtgctgtggtgatcaccaacgcaaatgacggagaaaagcgcatgttcgta
ggcaaacaacatgcagcggaagaatggatagatttgaccgggcgtcacgatcatactgta
aagattgagcaggatggctacggcatatttcccgttcgtgccggcagtgtatcggtgtgg
gcacttcccgcagaggaagacagccaggaaacagaagaagaagcgaacgcttaa

DBGET integrated database retrieval system