KEGG   Paenibacillus polymyxa CR1: X809_41430Help
Entry
X809_41430        CDS       T02956                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
ppol00440  Phosphonate and phosphinate metabolism
ppol01100  Metabolic pathways
ppol01120  Microbial metabolism in diverse environments
ppol01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    X809_41430
Enzymes [BR:ppol01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     X809_41430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: AIW42310
LinkDB All DBs
Position
complement(5863260..5864159)
Genome map
AA seq 299 aa AA seqDB search
MKKTKQLRDLVNSQKPEFIMEAHNGLSAKIVEEAGFKGIWASGLSISAAMGVRDNNEASW
TQVLDVLEFMSDATSIPILLDGDTGYGNFNNARRLVKKLEQRHIAGVCIEDKRFPKTNSF
INGQEQTLADIEEFSGKIKAMKDTQTDTDFTVVARVEAFITGSGLKVALQRAEAYRKAGA
DAVFIHSKRSDAAEIEAFMKEWAGRLPVVIVPTKYYTTPTIRFQEMGISLVIWANHNLRA
SIQAMKQLSGRIYRDESLVHVEKEVATLEEVFRLQGVEELQAAEKKYLPSSEPDSGERV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaaagcaacttagagacttggtcaattcacaaaaaccagagtttatcatg
gaggctcataatggtctgtcagccaaaattgtggaggaggcaggatttaaaggaatttgg
gccagcgggttatccatctctgcagcgatgggagtaagggacaacaatgaggcctcctgg
acgcaggttttggatgttttggaattcatgagtgacgctacctccatcccgattttgttg
gacggagatacggggtacggcaacttcaacaatgcaaggcgcttggtgaagaaactggag
cagcgccatattgcgggggtatgtatcgaagataagcggttccccaaaacgaattctttc
attaacggtcaagagcagactttggctgatatcgaagagttttccgggaaaattaaagcg
atgaaagatacgcagacggacacggattttacggtggtggccagagtagaggcatttatt
accgggagtgggcttaaagtggcgctgcagcgggcggaggcatatcgaaaggcaggagcc
gatgccgtatttatacacagcaaaagatcggatgccgcagagattgaagcgttcatgaaa
gaatgggctggaagattgccagtagtgatcgtgcctaccaaatactatacgactccaacc
atcaggtttcaggagatggggattagccttgtgatttgggcaaaccataatttgagagca
tccattcaagccatgaaacaattatctggccgaatttatcgggatgaaagccttgttcat
gtcgaaaaggaagtcgcaaccctcgaagaagtattccggcttcaaggggtcgaagagctg
caagctgcggaaaagaaatatcttccatcgtcagaaccggattcgggtgagcgcgtataa

DBGET integrated database retrieval system