KEGG   Paenibacillus polymyxa Sb3-1: RE92_00740Help
Entry
RE92_00740        CDS       T03812                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ppoy  Paenibacillus polymyxa Sb3-1
Pathway
ppoy00010  Glycolysis / Gluconeogenesis
ppoy00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ppoy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RE92_00740
   00500 Starch and sucrose metabolism
    RE92_00740
Enzymes [BR:ppoy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     RE92_00740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_42
Motif
Other DBs
NCBI-ProteinID: AJE49671
LinkDB All DBs
Position
complement(182767..184182)
Genome map
AA seq 471 aa AA seqDB search
MSTQFPKDFLWGGAVAANQLEGAYQEDGKGWSIQDVTPRGGWGPVTDVPTEDNMKLIGID
FYHHYKEDIKLFAEMGFKVFRTSIAWSRIFPNGDELEPNEKGLQFYDDLFDELHKYGIEP
LVTLSHYETPLHLSREYDGWVNRKLVDFYERYATTVFNRYKDKVKYWLTFNEINSILEAP
FMSGGISTPKDQLSEQDLYQAIHHELVASARAVKIGHQINPDFKIGCMVLSMPTYPLTPN
PDDVIAAMEFDHRNMAFADIHARGQYPGYMKRFFKENGISIHFEPGDAEDLKHTVDFISF
SYYMSTCETADEAKKVKGEGNILGGVSNPHLEASEWGWQIDPQGLRYVLNTFYDRFQKPL
FIVENGLGAVDELITNEKGEKTVEDDYRINYLNDHLVQVGEAIEDGVEVLGYTSWGCIDL
VSASTAQLKKRYGYIYVDRHDDGSGTLERYRKKSFHWYKEVIATNGESLKR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacagtttccaaaagatttcctgtggggcggagcagttgctgctaatcagctc
gaaggcgcttatcaagaagacggaaaaggctggtccattcaggatgtaactcctcgtggt
ggttgggggccggttacggatgtaccaacagaagataatatgaagttgatcggtattgat
ttttaccatcattataaagaagatatcaaactttttgcggaaatgggctttaaagtgttc
cgtacttccattgcttggtcacgtattttccctaatggtgacgaacttgagcctaatgaa
aaaggcttgcaattttatgatgatttgtttgatgaacttcataaatatggtattgagcca
ctcgttacattatctcactatgaaacacctttacatttgtccagagaatacgatggttgg
gtaaaccgtaagcttgttgatttctatgagcgctatgcaacaactgtatttaatcgctac
aaagataaagtaaaatactggttgacgttcaatgaaatcaactccattcttgaagcacca
ttcatgagtggcgggattagcacaccaaaagatcaacttagtgaacaagacctttatcaa
gctattcaccatgagctggtagcgagtgcaagagcagtaaaaatcggtcatcagattaat
cctgatttcaaaattggttgtatggtactgagtatgcctacttatccgctgacacctaat
ccagacgatgtgattgcagcaatggaatttgatcacagaaacatggcatttgccgatatt
catgcaagaggtcagtatccaggttacatgaaacgtttcttcaaagaaaacggaatctct
attcattttgagccaggtgatgctgaagatctgaagcatacggttgattttatctcgttc
agttattatatgagtacttgtgagacggctgacgaagctaaaaaagtcaaaggtgaaggt
aacatcctcggtggggttagcaatccgcatctcgaggcaagtgagtggggctggcaaatt
gatccgcaaggtctgcgctatgtgctgaatacattttatgatcgcttccaaaaaccactg
ttcatcgttgaaaatggtctgggcgctgtggacgagcttatcaccaatgaaaaaggtgaa
aaaacggttgaagatgactaccggatcaactatctgaatgatcatttggttcaagttggg
gaagcgattgaagatggagtagaggttctgggctatacatcttggggctgtattgatctt
gtcagcgcgtcgactgctcagcttaaaaaacgttatggctacatttacgtagatcgtcat
gatgatggtagcggtacacttgaaagatatcgaaagaaatcgttccactggtacaaagaa
gttattgctacgaacggtgaaagcttgaagcgttaa

DBGET integrated database retrieval system