KEGG   Paenibacillus polymyxa Sb3-1: RE92_02850Help
Entry
RE92_02850        CDS       T03812                                 

Definition
(GenBank) transcriptional regulator
Organism
ppoy  Paenibacillus polymyxa Sb3-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 Penicillinase_R HTH_24 TrmB Sigma70_r4
Motif
Other DBs
NCBI-ProteinID: AJE50066
LinkDB All DBs
Position
692238..692693
Genome map
AA seq 151 aa AA seqDB search
MNNLPPDCSIGMLLGITHRKMSQQLLHRLKPYDISPEQWSVLYQIYQAEGLNQKEIAAKA
VKDQPTTTRIIDLLDKKGWVRRVNSPQDRRAYLLHLTEAGRQLVEETLSVERDANHDFVK
GISSADLKQFRHILLQIHTNMTESEKQGEND
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatttgcctcccgattgctctattgggatgttgctcgggatcactcatcgtaaa
atgagccaacagctcttacatcgtcttaaaccttatgatatttccccagagcaatggtcg
gttctataccaaatctatcaggccgagggtttaaatcagaaagaaattgctgctaaggcc
gtaaaggatcagcccactacgacccgtattattgatttgttggacaagaagggctgggta
cgacgtgtgaatagcccgcaggaccgccgggcctatttgcttcatttgactgaagctggt
cgacagcttgtggaggagaccctctccgtcgaacgggatgccaaccacgattttgtaaaa
ggaatttcctctgccgatctaaagcaattccgccacattcttttacaaattcataccaac
atgactgaatcagaaaaacaaggagagaacgattaa

DBGET integrated database retrieval system