KEGG   Paenibacillus polymyxa Sb3-1: RE92_03950Help
Entry
RE92_03950        CDS       T03812                                 

Definition
(GenBank) hypothetical protein
Organism
ppoy  Paenibacillus polymyxa Sb3-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PgpA
Motif
Other DBs
NCBI-ProteinID: AJE50266
LinkDB All DBs
Position
complement(919150..919647)
Genome map
AA seq 165 aa AA seqDB search
MSYEYAETLLNRRGIQIESIADIVFQLQLKYYPHLTMEECVESVKAVLQKREVQYTLLTG
IALDELAEKKLLPQPLQAIMEADEPLYGVDETMALGITSVYGMIGLTSFGYLDKEKIGII
EKLNQKGSGIHVFLDDLVAGLAAAASSRIAHRSLHAKHYPASLDV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatgaatatgcagaaaccttgttaaatcgcagaggcattcagatcgagtccatt
gcggacattgtttttcagcttcagctaaaatattatcctcatttgactatggaagaatgt
gtagaaagtgtcaaagcggttttgcaaaagcgagaggtacaatatacactgctgacaggc
attgcgcttgatgagctggccgaaaaaaaacttcttccccagccacttcaagccattatg
gaggcagacgaaccgctgtatggagtggacgagacaatggctcttggcattacgagcgtg
tacggcatgatcggcttgactagttttggctatctggataaagaaaagattggaattatc
gaaaagctgaaccaaaaaggcagtggtattcatgtgtttttagatgatcttgtcgccgga
ttggctgccgccgcttcttcgcgtattgcccatcggagccttcatgccaagcattatcct
gcatcattggatgtttaa

DBGET integrated database retrieval system