KEGG   Paenibacillus polymyxa Sb3-1: RE92_05570Help
Entry
RE92_05570        CDS       T03812                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ppoy  Paenibacillus polymyxa Sb3-1
Pathway
ppoy00473  D-Alanine metabolism
ppoy01100  Metabolic pathways
ppoy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppoy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RE92_05570
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    RE92_05570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppoy01011]
    RE92_05570
Enzymes [BR:ppoy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RE92_05570
Peptidoglycan biosynthesis and degradation proteins [BR:ppoy01011]
 Precursor biosynthesis
  Racemase
   RE92_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: AJE50564
LinkDB All DBs
Position
complement(1251030..1252226)
Genome map
AA seq 398 aa AA seqDB search
MQAQYRSTRAEINLDHLGANYEAFRKVLPADKLILVCVKANAYGHGAVEISKEMERLGAD
YLSVAFLDEALELRHAGIELPILVLGYTSPEAVQTAWEHDISLTVFSEEVLEGIRRLDRQ
GSERKLKVHIKIDSGMGRLGLLPGEAALAFVRQAHELEQVLLEGMYTHFARADEEDKSYT
LLQYDRFRGVADALREQGITIPIIHTGNSAATIDTPSLSPNMVRIGISIYGLYPSDEVNR
QVIELLPVLSLKTAVVYTKTLPPGWGVSYGTRYVTSSEERIGTLPIGYADGYSRMLSGKV
EVLIRGRRVPVLGTICMDQCMVSLQSFAEDAEEIQTGEEVVLIGQQSGEIIAADELASKL
GTIHYEVICMIADRVPRVYMRDHVPVVRVNSLLPTHWN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagcacaatacagatcgacccgggccgaaatcaacctggatcaccttggcgccaac
tatgaagcctttcgcaaggtattgcctgcggataagctgatactggtctgtgtcaaggct
aatgcctacgggcacggtgccgtagaaatttcaaaggaaatggaacgccttggtgcggat
tatttgagcgtcgcttttctggatgaggctcttgagcttcgtcatgcggggattgaactg
ccgatccttgtactcggctatacctcgcctgaagctgtccaaacagcttgggagcatgat
atctcattgactgtgtttagtgaggaagtgctggaaggtatccgcagattggaccgccaa
ggaagcgaacgcaagctgaaggtgcacatcaaaatagacagcggcatgggaagactcggt
ttgctgcctggagaagcggctttggcttttgtccggcaggctcacgaattagagcaggtg
ctgctggaaggcatgtacacccattttgcccgcgcggatgaagaagataaaagctataca
ctgctacaatatgatcggtttcggggcgtggcggatgcgctaagggaacaaggtattact
attcccattatacatacgggcaacagcgcggccaccattgataccccttccctttccccc
aatatggtgcggattggcatcagtatatacggtttgtatccgtctgatgaggttaaccgg
caagtcattgaactgttgcctgtattgtcattaaagacggcggtggtttataccaagacg
cttcctcctggatggggagttagttatggtacccggtatgtgacctctagtgaagagcgg
atcggcacactgccaatcggttatgcggatggatattctcgcatgctaagtgggaaggtt
gaagtgttgatacgcggtcgtcgcgtccctgtactcggtacgatctgcatggaccagtgt
atggtatccttacaatctttcgcagaggatgcggaagaaatccaaaccggcgaagaggtt
gttctcatcggccagcagtccggcgaaatcattgcggcggatgagctggcatccaagctt
ggtacgatccactatgaggtgatctgcatgatcgcagacagggtaccgcgtgtttacatg
cgagatcatgttcctgtcgttcgggtgaactcgcttcttccaacccactggaattaa

DBGET integrated database retrieval system