KEGG   Paenibacillus polymyxa Sb3-1: RE92_10045Help
Entry
RE92_10045        CDS       T03812                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ppoy  Paenibacillus polymyxa Sb3-1
Pathway
ppoy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppoy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    RE92_10045
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppoy03400]
    RE92_10045
Enzymes [BR:ppoy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RE92_10045
DNA repair and recombination proteins [BR:ppoy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RE92_10045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AJE54046
LinkDB All DBs
Position
2272199..2273149
Genome map
AA seq 316 aa AA seqDB search
MKPVIPFEPELSEKVPVDAGLWRYEIKWDGTRILTYHDQGSTRLFNRKQHERTLLYPELA
RFSSYCRADSVILDGEMIALGADGKPSFHEIMRRDLIRRTDRIQAAYKAVPATYMLFDIV
YLNGEWVHRKPLQERLELLHQIIIPNERIQLAPAHPDGQALFQVMCSQGMEGIVCKKLDS
PYTLGGQDRRWVKVKNYGDIIAVIGGYTLNGGVINAVLLGQYDRQGMLRYIGHVGTGKLT
RGDWRQLTERLLPHTISERPFINKPDRHQDAFWVKPMFTAKIQYSEWRWQEGRTLRQPSI
QALVDQGIEQCIGPWK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgtcatcccgtttgaaccagaactgagcgaaaaggtccctgtagatgcaggc
ctttggcgttacgaaataaaatgggacggtacaagaattttaacgtatcacgatcagggc
agcacgcgtctgttcaatcgcaagcagcatgaacgaacgctattgtacccggagcttgct
cgcttctcctcctactgcagggcagattcagtcatactggacggggagatgatcgcactt
ggtgccgacggtaaaccgtcgttccatgaaattatgcgccgggatctgattcgccggacg
gatcgaattcaggcagcctataaagccgtacccgctacttacatgttgttcgatattgtt
tatctaaatggggaatgggttcatcgcaaaccgttacaggaaaggcttgaactgctgcat
cagatcatcataccgaatgaacggatccaactggctcccgctcatcctgatggacaagct
ctatttcaggttatgtgcagccaaggaatggaaggtattgtgtgcaaaaaactggatagt
ccatacacattgggcggacaggacagacgatgggtcaaggtcaaaaattatggtgatatc
attgccgttatcggtggctataccctaaacggaggcgttatcaacgctgtattgctgggc
cagtatgatagacaaggaatgctgcgctatatcgggcacgtggggacaggtaagctgact
cgtggagattggcgtcagctaaccgagcgcctcttgccacataccatatcggagcgacct
tttattaataaaccggatcggcatcaagacgcattttgggtaaagcccatgtttaccgcc
aagattcaatatagtgaatggcgatggcaagaaggacgtaccttgcgtcagccctccatc
caagctcttgtggatcaaggtattgaacagtgcatcggaccttggaagtga

DBGET integrated database retrieval system