KEGG   Paenibacillus polymyxa Sb3-1: RE92_14275Help
Entry
RE92_14275        CDS       T03812                                 

Definition
(GenBank) flagellar capping protein
  KO
K02407  flagellar hook-associated protein 2
Organism
ppoy  Paenibacillus polymyxa Sb3-1
Pathway
ppoy02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ppoy00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    RE92_14275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ppoy02035]
    RE92_14275
Bacterial motility proteins [BR:ppoy02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    RE92_14275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliD_C FliD_N Flagellin_IN Glyco_hydro2_C5 ComC DUF1033
Motif
Other DBs
NCBI-ProteinID: AJE52141
LinkDB All DBs
Position
3229195..3230697
Genome map
AA seq 500 aa AA seqDB search
MRINGFSGMDIDSMVTSLMTAKKTPLNKLNQQKQTLEWTRDSYRELNTKIVQFRAKLFDM
GSKSEAMNTQKATLTGNTTAIKAEANADASSTPMSVVVNKLATKSNMQTSTGLRTAGSST
ADATKNTTLEQIAGGSASDTYELNINDKTITFLKTDTITAVMARINSEGANVTATFDEIS
GKFSITAKDYGDSNNIKLTGADKQVKSSTLMDLFQISSTDVKAAEKGEVIVTNTADSSSK
TYNPDKNFLVVNGVSLTLLETTGTTGPAKITTQSDPTKAMETIKSFVDTYNDLLSTFNTK
LSEQKYRDFPPLTADQRKDMKEDEIKQWEEKAKSGLLKNDTILSSAVSSMRMTISSKLGD
LSSIGITTGQYYENGKLQINEEKLKAALTTDPDKVMNIFKGSSADVNSKPIFSELRSKLD
TTLDMFVKKAGTSKFDTNASMTLKADSIMGKQLKNYNSDIKEMTKKLADAETRYYKQFSA
MESAMSKYQSQSSSLTSFLQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcgtataaatggtttttcaggaatggatatagatagcatggttacatccttaatgact
gcaaaaaaaactccgttaaacaagctgaatcagcagaagcagacattagagtggacgcgt
gatagctaccgtgagttaaatactaaaatcgtacaatttagagctaaattattcgacatg
ggtagtaagtcagaggcaatgaacactcagaaagcaacgttaactggtaatacaacggct
attaaagcggaagctaatgctgatgctagctctacacctatgtctgtagttgttaacaag
ttagcaacaaagtccaatatgcagacctctacaggtctacgtacagccggaagcagcacg
gcggatgctactaaaaatacaacattggagcaaattgcaggtggcagtgcgtctgatact
tatgagttaaatatcaatgataaaacaatcacttttcttaaaactgatacaataactgca
gtgatggcccgtatcaattcagaaggggcgaacgtaacagcaacctttgatgaaatcagc
ggcaagttctccattacagctaaagactatggggatagcaataatattaaattaactggt
gctgataagcaggttaaaagcagtacgctcatggatttattccaaattagttctacagat
gtaaaggcggctgaaaaaggggaagttatagtaacgaatactgcagattcgagttccaaa
acttataatcctgataagaacttccttgtcgttaatggagtgtcgctgactctgttagag
accacgggaactactggaccagctaaaatcacaacccagtcagatccaacaaaagctatg
gagaccattaaatcttttgtggatacttataatgacctattaagtacattcaatacgaaa
ctaagtgaacaaaagtatcgcgatttccctccactgacagccgatcaaaggaaagacatg
aaggaagatgaaattaagcagtgggaagaaaaggcgaaaagtggtctcctcaaaaatgat
acgattttaagttctgctgtatcttctatgcgaatgactatttctagtaaattaggcgat
ttgagttcaattggtattacaacaggccaatattacgagaatggtaaattacaaattaat
gaagagaaactgaaggctgctttgacgacagatcctgataaggttatgaatatattcaaa
gggtcgtccgctgatgtaaacagcaagcccatctttagcgagttgagaagtaagcttgat
actacgttagacatgtttgtaaaaaaagcaggtacatcaaaattcgatacaaatgctagt
atgaccttaaaggctgacagtataatgggaaagcagcttaaaaactataacagcgatatt
aaagagatgaccaaaaaacttgctgatgcagaaacacgctattataagcagttttcggct
atggaatcggctatgagcaagtaccagtcgcagtcgtccagtttgacaagctttttacaa
tag

DBGET integrated database retrieval system