KEGG   Paenibacillus polymyxa Sb3-1: RE92_16875Help
Entry
RE92_16875        CDS       T03812                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ppoy  Paenibacillus polymyxa Sb3-1
Pathway
ppoy00020  Citrate cycle (TCA cycle)
ppoy00190  Oxidative phosphorylation
ppoy00650  Butanoate metabolism
ppoy01100  Metabolic pathways
ppoy01110  Biosynthesis of secondary metabolites
ppoy01120  Microbial metabolism in diverse environments
ppoy01130  Biosynthesis of antibiotics
ppoy01200  Carbon metabolism
Module
ppoy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppoy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppoy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RE92_16875 (sdhA)
   00650 Butanoate metabolism
    RE92_16875 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RE92_16875 (sdhA)
Enzymes [BR:ppoy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RE92_16875 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     RE92_16875 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored NAD_binding_8 FAD_binding_3 AlaDh_PNT_C DAO Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AJE52600
LinkDB All DBs
Position
3820834..3822579
Genome map
AA seq 581 aa AA seqDB search
MAASNIIVVGGGLAGLMATIKAAEAGVHVHLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDSVYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAFAGATTGQQLLYALDEQVRRWESAGLVTKYENWEFLQAVLDDEGICRGICGQDLR
TMEVKTFAADAVILASGGPGIIFGKTTNSVINTGTAAGAVYQQGVRYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFSVCVDDG
LGINGENMVYLDLSHKDPKELDVKLGGIIEIYEKFVGDDPRKIPMKIFPAVHYSMGGMWV
DYNQMTNIPGLFAAGECEFQYHGANRLGANSLLSAIYGGMVAGPKAVEYIKGLKKSAQDV
ASSVFDAAVNQQTEKYERILHMDGKENAYVLHKELGEWMTNNMTVVRYNDKLEATIHKIK
ELKERYSNININDASRWNNAGAAFTRQLWNMMELAEAMTKGALLRNESRGAHYKPDFPDR
NDEDYLKTTIADWTPEGPQISYEEVDVSLIKPRVRDYSKSK
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatccaatattattgtcgtgggcggcggtctggcaggtctaatggctacgatc
aaggcggcagaggcgggagtccacgttcatttattttctttggttccggtcaaaagatcc
cactccgtttgtgcgcaaggtggcattaacggtgcggtaaataccaaaggtgagggagac
tcgccctggattcactttgacgattcagtctatggcggtgactttctggcaaaccagccg
ccggtaaaagcgatgtgcgaagcggctccgggaatcatccatctcatggaccgtatgggt
gttatgttcaatcggacaccagaaggactgctggatttccgccgttttggcggtacccag
catcatcgcacagcctttgctggtgcgacgacaggacagcagctcctgtatgctctcgat
gagcaggtacgacgctgggaatctgctggtttggtgaccaagtacgagaactgggagttt
ttacaggctgtactggatgatgaaggcatctgtcgagggatttgcgggcaagatttgcgt
acgatggaagtgaagacttttgcagcggatgccgttattctggcatctggtggtcccggg
attattttcggtaaaaccacaaattccgtcattaataccggcacggctgccggtgcagtg
tatcagcaaggcgttcgctatgcgaacggtgagtttatacagattcatccaacggctata
cctggtgacgacaagctgcgtctcatgtccgagtcggcacggggagagggcggtcgcatt
tggacgtataaagacggaaagccatggtatttccttgaagaaaaatatccggcttatgga
aatctggtccctcgcgacattgcgacacgtgaaatattcagcgtatgcgttgatgatgga
ctgggtattaacggcgagaacatggtctatctggatctgtctcacaaggacccgaaagag
ctggatgtaaagctgggcggcattattgagatttatgaaaaatttgtcggcgacgatccg
cgtaaaatcccaatgaaaatattcccggctgttcactattcaatgggcggcatgtgggtc
gattacaaccaaatgacaaatataccgggtctgttcgcagctggtgaatgtgaattccag
tatcacggagcgaaccgcttgggtgcaaactcactgctgtcggccatttatggcgggatg
gtggctggaccaaaggctgtggaatatatcaagggcttgaaaaagtctgcacaggatgta
gcttcttcggtatttgatgccgcagtcaatcagcagacggagaagtatgagcgcattttg
catatggacggaaaagaaaatgcctatgttcttcacaaagagctgggtgagtggatgacg
aacaatatgaccgtggttcgttataatgacaagctggaagctacgattcacaagatcaag
gagctgaaggaacgttactcgaacattaacattaatgacgcttcgcgctggaataatgcg
ggtgcggcgtttacacggcagttgtggaatatgatggaactggctgaagcgatgaccaaa
ggggcgctactgcgcaacgaaagccgcggggcccattacaagccggacttcccggatcgc
aacgatgaagattatctgaaaacgacgattgcagattggacaccggaaggaccacaaatt
tcgtatgaagaggtcgacgtttcactgatcaagccgcgtgttcgagattattccaagagc
aagtaa

DBGET integrated database retrieval system