KEGG   Paenibacillus polymyxa Sb3-1: RE92_16880Help
Entry
RE92_16880        CDS       T03812                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ppoy  Paenibacillus polymyxa Sb3-1
Pathway
ppoy00020  Citrate cycle (TCA cycle)
ppoy00190  Oxidative phosphorylation
ppoy00650  Butanoate metabolism
ppoy01100  Metabolic pathways
ppoy01110  Biosynthesis of secondary metabolites
ppoy01120  Microbial metabolism in diverse environments
ppoy01130  Biosynthesis of antibiotics
ppoy01200  Carbon metabolism
Module
ppoy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppoy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppoy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RE92_16880 (sdhB)
   00650 Butanoate metabolism
    RE92_16880 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RE92_16880 (sdhB)
Enzymes [BR:ppoy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RE92_16880 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     RE92_16880 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_2 Fer4 Fer4_13 Fer4_21 Fer2_4 Fer4_4 Fer4_16 Fer4_6 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AJE52601
LinkDB All DBs
Position
3822599..3823366
Genome map
AA seq 255 aa AA seqDB search
MSEQAVKSNKTVKFVVTRQDEPNASSYTEEFELAYRPGMNVISALMEIQRNPVDSQGKET
APVCWESNCLEEVCGACSMVINGKPRQACAALVDKLEQPITIAPMSTFPVVRDLVIDRSR
MFNALKKVKAWIPIDGTYDLGPGPRMAEKKRQWAYELSKCMTCGVCLEACPNVNEKTTFI
GPAAISQVRLFNSHPTGEMNQEERLDALMTDDGLEGCGNSQNCVRSCPKGIPLTTSIAEM
NKQTTKHMFKRWLTV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcaagcagtgaagtcgaataaaacagtgaagttcgtggttactcgtcaggat
gagcctaatgctagttcctatacggaagaatttgaattggcctacagaccgggaatgaac
gtgatcagcgcgctgatggaaattcagcgtaacccggtagacagccaaggtaaagagacg
gctccggtgtgctgggagtcaaactgcctggaggaagtatgtggagcttgttctatggtg
attaacggcaagccacgtcaggcgtgcgcagcgctcgtcgataagctggagcagccgatt
acgattgcgcccatgagtacattcccggtagtacgggatttggtcattgaccgcagccgg
atgtttaacgcgctcaagaaggtcaaagcgtggattccgattgacggtacctacgatctg
ggaccgggtcctagaatggcagagaaaaagcgtcagtgggcatatgagctgtccaagtgc
atgacctgtggtgtctgtctggaagcatgcccgaacgtcaatgagaagacgacgttcatc
ggtcctgcggcgatatctcaggttcgcctgtttaacagccatccgacaggggaaatgaat
caggaagagcgcctggatgcattgatgacggacgacgggctagaaggctgtggtaattcg
caaaactgcgtacgctcttgcccgaaaggcattccgttgacaacttctattgccgaaatg
aacaagcaaacgactaagcatatgtttaagcgctggctgactgtgtag

DBGET integrated database retrieval system