KEGG   Physcomitrella patens subsp. patens: 112274461Help
Entry
112274461         CDS       T01041                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00010  Glycolysis / Gluconeogenesis
ppp00051  Fructose and mannose metabolism
ppp00052  Galactose metabolism
ppp00500  Starch and sucrose metabolism
ppp00520  Amino sugar and nucleotide sugar metabolism
ppp01100  Metabolic pathways
ppp01110  Biosynthesis of secondary metabolites
ppp01200  Carbon metabolism
Module
ppp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ppp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112274461
   00051 Fructose and mannose metabolism
    112274461
   00052 Galactose metabolism
    112274461
   00500 Starch and sucrose metabolism
    112274461
   00520 Amino sugar and nucleotide sugar metabolism
    112274461
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    112274461
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppp04131]
    112274461
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     112274461
Membrane trafficking [BR:ppp04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    112274461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 112274461
NCBI-ProteinID: XP_024359760
LinkDB All DBs
Position
21
AA seq 517 aa AA seqDB search
MGQSKVLVGVYIACAAAACATAAVAVTQRLKVRAQKCTARKILVEFQEACETPLPRLRQV
VDAMAVEMHAGLVSEGGSKLKMLPTFIDRLPNGSEKGLYYAVDLGGTNFRVLRVQLGGLE
GRVIKQEYEEVAIPPELMLGTSEQLFHFIAKELAGFVAREGEEFRLGDGQSREIGFTFSF
PCKQTAVNSGTLLQWTKGFKVNDAIGQDVVAALQKCIERLGCKMRIAALVNDTVGTLAGG
RYWNNDVMIAVILGTGTNACYVERAESISKWTGELPKSGQMVINMEWGNFWSSHLPRTYV
DELLDSESLHPGEYGFEKMISGMYLGDCVRRVLVRMAQEAGIFGPHVPHTLLESFSLQTP
EMSRMHHDDSSDLKVVAEVLKRLYGIQNTTVGIRKIVVAVCDTTCQRGARLAAAGIVGIL
KKIGRDGSTANGLMRRNDTNGIHDELSVNSTPGSGKTVVAMDGGLYEHYSKFRNYMQEAV
RELLGDASKNVSIELSKDGSGIGAALLAASYAEYVPS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgggacaatcgaaggtattggtaggtgtgtacattgcttgcgcagctgcggcatgcgca
accgcagctgtggcggtgacgcagcgactgaaagtgcgagcgcagaagtgcactgcgcgg
aaaattttggtggagtttcaggaggcttgcgagacgcctctgccgcggttgcggcaagtt
gtggatgctatggccgtcgagatgcacgctggcctcgtgtcggaaggcggaagcaagctt
aagatgctgcccaccttcattgatcgcttgccgaatgggagcgagaagggcctttattat
gctgtggacttgggtgggacaaacttccgggtgctccgtgtccagttgggtggattagaa
ggtagagtaatcaagcaagagtacgaggaagttgccattccccctgagctaatgcttgga
acaagcgaacaactatttcattttattgccaaggagttggctggctttgtggcaagagaa
ggtgaggaattcaggttaggcgacggtcagtcacgggaaatagggttcaccttttccttc
ccctgtaagcaaaccgctgtaaattctgggactctcttgcaatggaccaagggcttcaaa
gtgaacgatgcaatcggccaagatgtggtcgcagctcttcaaaagtgcattgaacgacta
gggtgcaagatgaggatcgctgctttggttaacgatacagtgggtactctagctggtggt
cgctattggaataacgacgtgatgatagctgttattttgggtactggtaccaatgcctgc
tacgttgagcgggctgaatctatatcgaagtggactggcgagcttccgaagtctggccag
atggtgatcaatatggagtggggaaacttttggtcatcacatttgcctcggacctatgtg
gatgagttattggatagcgagagcctccatccaggagaatatggttttgaaaagatgatt
tctggaatgtatttgggtgattgtgtgaggcgagtgcttgtcaggatggcacaagaagct
ggcatcttcggtccccatgttcctcacacactcttggaatccttctcgctccagacacca
gaaatgtcaagaatgcaccatgatgacagtagcgacctaaaagtagttgcagaagttctg
aaaagactatatggaatccagaacacaacagtagggattcgcaaaatcgtagttgctgtt
tgcgacactacgtgccagcgaggggccaggctggcagctgctggtattgtgggaatacta
aagaaaattgggagagatggaagtacagcaaatggcttgatgaggcgaaatgatacgaat
ggtatccatgacgagctctctgtgaattctacaccgggaagtggtaagaccgttgtggct
atggacggtggcttgtatgagcactacagcaagttccgaaattacatgcaagaagctgtg
cgtgagcttctaggggacgcatccaaaaacgtctctatagagctctccaaggatggctca
ggcattggggcagcccttctagctgcatcatatgccgagtatgtgccctcctaa

DBGET integrated database retrieval system