KEGG   Physcomitrella patens subsp. patens: 112274954Help
Entry
112274954         CDS       T01041                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF-like isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    112274954
Enzymes [BR:ppp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     112274954
Chromosome and associated proteins [BR:ppp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     112274954
   Polycomb group proteins
    PRC2-EZH2 complex
     112274954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR RE_HindIII
Motif
Other DBs
NCBI-GeneID: 112274954
NCBI-ProteinID: XP_024360605
LinkDB All DBs
Position
22
AA seq 999 aa AA seqDB search
MASSSYAIKEEDHEDYEEEEDDEDAAGETVAIALQGFMEQVQCERQAYVKRRMNSNKERL
KGYTWNLLKLDQERKSVWERREVSSFSSLCQKKHQAYGNLNGSDSSGEKDGRLATQESGG
LDKPISIIFGCQTGGKTAIRPVKLRKVENVPPYTTWIYLDRNQRMTEDQSVVGRRRIYYD
SDGNETLIASDSEEEDPGDDDDKDEPKHDFSKGEDTLIWMSIQELGLKSVVLNELSDVLD
IKPEEIEARYDILLKDFAKNGGSEMLLPTAVGTTRDKEFTRGTFQEFSLFNSGKEAVKEE
NELPDTQEDDDNETKDLLAAMDSFDTLFCRRCLVFDCRLHGCSQAIVHPSERQQPWSGTE
EDPSPCSKDCYLLTDPNYVTKTRLRPEVPPRGDVDAGLRDVSQSPEQGQTATNGQEDDVG
VSERFSKRSGMSSRERSSSSETQAWAAPTILDPGATQPVGRTGSWSKVGSKEKKSEKRPS
ATRRSLRVRRNCPQEDTSALLKPQLSQEESVISLDSDSQDFPKEESPSLKGEGSSYQDEA
FKVKKARQGVLPSKRKKDVEKDGEVEKDDDMEKDDDVDKDEDRDKDDDMDKDDLEKDDDL
EKDDDTSREGEADEKIAVASAPEGFAFKEGQDEAPGQAVKVEVGVGWTEMEKGLYEKGLQ
IFGRNSCLVSRNLLQGCKTCAEVAKYAMELDAAGLGGVRRIADSLDTEAASRARLYGVRR
KKNMRKLKYTFKSVVHPLIRKRLANGKDQTCRQYTPCNCLYTCGKQCPCLLNGTCCEKYC
GCSKSCKNRFRGCHCAKSNCCSRQCPCFAAGRECDPDVCRNCWVGCGEKHVKPAVEYTCH
NMKLMLKQQQRVLLGRSDVAGWGAFLKKTVAKHEYLGEYTGELISHREADKRGKIYDREN
SSFLFNLNDQYVLDACRKGDKLKFANHSPTPNCYAKVIMVSGDHRVGIFAKERIGAGEEL
FYDYQYEPDRAPVWARKPDDPNNKRDDMPSTGGRAQKVA
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctccagctacgccatcaaggaggaagatcacgaggattatgaggaggaagaa
gatgatgaagacgcggctggagagacggttgcaattgcccttcagggttttatggagcaa
gtgcaatgtgaacggcaagcatatgtaaagcgacgcatgaattcgaacaaggagcggttg
aagggctacacatggaatcttttgaaactggaccaggagcgcaagtcggtatgggaaagg
agagaagtgtcgagcttctcctcactttgtcaaaaaaaacatcaagcttacggcaacttg
aatggctcagattcctccggagagaaagatggcagattagctacccaggaatcgggtggt
ttagacaagccaatatccattatttttggatgtcaaacgggcggaaagacagccattcgg
ccagtgaagctacgcaaagttgagaatgtgccaccgtacacaacatggatctatttagat
aggaaccaacgcatgacagaagatcaatctgtagtgggccgacgtcggatctactatgat
agtgatggcaatgaaactctaatcgccagtgatagtgaagaagaagatcctggggatgat
gatgacaaagacgaacctaagcacgacttcagcaagggtgaagacaccttaatctggatg
tccatccaggagcttggattgaagtcggtggttttgaatgagctctccgatgtccttgac
ataaaaccagaagaaatcgaggcaaggtatgacatcctgttaaaagattttgctaagaat
ggtgggagtgagatgctgctgccaactgctgtagggactacccgtgataaagaatttact
agaggaacttttcaagagttttcattgttcaactctggaaaggaagctgtgaaggaagaa
aatgaacttccagacacgcaagaggatgatgacaatgaaacgaaagacctcctggctgct
atggattcttttgacactctgttttgcaggcgctgtttggtatttgactgccgattacat
ggatgctcccaagctatagtccatccaagtgaaaggcaacaaccatggagtggcacagaa
gaagaccctagtccttgcagcaaagattgttatttgttgactgatccaaactacgtgaca
aagaccagattacgtcctgaagttcccccccgaggagatgttgatgcaggacttagagat
gtttcacagagtcccgagcagggccaaaccgctaccaacggtcaagaagatgatgtgggt
gtctcagaaagattttccaagaggtcggggatgtccagcagagaaaggtcaagttcctca
gagactcaggcatgggctgcaccgacaatacttgatccaggagcgacccaaccggtaggt
cgcaccggtagctggtctaaagtaggctcaaaagagaagaaatcagaaaaacgcccgagt
gccacacgcaggtcactccgtgtgagacgtaattgcccacaagaagatacttccgctctc
ttaaagccacagttaagccaggaagaatctgttatctctctcgacagcgatagccaggac
tttcctaaagaagagtcaccctctttaaagggggaaggaagctcctaccaggatgaggct
ttcaaggtgaaaaaggcccgtcaaggcgtgttgccttcaaagaggaagaaggatgttgag
aaggatggtgaggttgagaaagacgatgatatggagaaagatgatgatgtggacaaggac
gaagatagggacaaggatgatgatatggataaagatgatctagagaaggatgatgatctt
gagaaagacgatgatacgtcgcgagaaggtgaagctgatgagaagattgctgtagcatct
gcacctgagggttttgctttcaaagaggggcaagatgaagctccaggtcaagcagtcaaa
gtagaagtaggtgttgggtggactgagatggagaagggtttgtatgagaagggtttgcag
atttttggcagaaacagttgcttggtatcgcgaaaccttcttcaaggctgcaagacgtgt
gcagaggtggccaagtacgcaatggaactagatgctgctggacttggtggtgtccgacgg
attgctgacagtttggatacagaggcagcaagcagagcacgattgtatggtgttcggcgc
aaaaagaatatgcgcaagcttaagtatacatttaagtctgtagtgcatccacttatacgg
aaaaggttggctaacgggaaggatcaaacgtgtcggcaatacacaccttgcaactgcctc
tacacttgtgggaagcaatgtccgtgcctacttaatggtacctgctgtgaaaaatactgt
gggtgctccaagagctgcaagaatcggttccggggctgccattgtgcaaagagtaattgc
tgtagtcggcaatgcccgtgtttcgctgcagggcgcgagtgtgaccctgatgtctgcaga
aattgctgggttggttgcggagaaaaacatgtaaagccggcagtggagtacacatgccat
aatatgaagctcatgctgaagcagcagcagcgggtgttactgggcaggtcagatgtggca
ggctggggtgcattcctgaagaaaacggttgccaagcatgaatacctcggagagtatact
ggtgaactcatctcccatcgagaggccgataaacgagggaaaatttacgacagggagaat
tcgtcgttcctcttcaatctaaatgatcagtatgtgctggacgcatgtcgaaagggcgac
aagctcaaatttgcgaaccattcacctactcccaactgctatgccaaggttattatggtt
tccggagaccatagggtagggattttcgctaaagaacgaattggagctggggaagaacta
ttctatgactaccaatacgagcctgatagagcgcccgtatgggcaagaaaacctgatgat
cctaacaacaagagggatgatatgccaagtaccggtggacgagcacagaaagttgcttaa

DBGET integrated database retrieval system