KEGG   Physcomitrella patens subsp. patens: 112275226Help
Entry
112275226         CDS       T01041                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2B-like isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00562  Inositol phosphate metabolism
ppp01100  Metabolic pathways
ppp04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112275226
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112275226
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ppp01009]
    112275226
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112275226
    3.1.3.48  protein-tyrosine-phosphatase
     112275226
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     112275226
Protein phosphatases and associated proteins [BR:ppp01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    112275226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDKN3 Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 112275226
NCBI-ProteinID: XP_024361169
LinkDB All DBs
Position
22
AA seq 910 aa AA seqDB search
MQTEERFLKMGVDCDSFPSRLGLPSNHPLGQPRSRSSSNRLVLERRQETQSLRNQAILKA
SEKALRERNPECYEPRQSSNPKSLLSLHTTSLSDFPSPPLPVAKSKHLSRSATFSSLESK
TERNLHSDYLSDRSSFVKLPLSGSGSDTGSNTLKPSEKEPSLPSSSQQATRADGPEMSVK
SLFRSSSFTSNRVPIVDSSDSQPTEAPSVATASEPMSSIKSFFRSSSFVHKSQEISSPIA
KSLSRSLSSLSNHGQESAKEQKADSSSGFSKWARSFRFKPTADVGVEISESSPYSLFSGP
SGKRASAKVSPIEGFENSFGVLTKGFIDSSRNAVKAVQDKARHLVSQNKHWYQDGQVQLD
IAYITENIIAVGFPGAESSSNILGFAEGNYQGHLEELVTFCENQHPGKYKIFNLCSEKLY
DASFLHDKVAYFPIRGNNCPLKLLSAFCEAAYTWLKEGLENVAVVHCKGGMERTGLMTSC
LLLHLRFFPSAEESINHYNLKRCAGSSCLELPSQLRYVKYYEQVSKKYHGCTPTGRKCTL
RSIRLNNCPAWIRPSVTVSDHNGVLFASRRHPNTSLMLTEDLWLSAMKSGVYVLELPEDG
HAAVVDGDFKVHFQNRHVDFSCWLNSNMEGNIIFRVEDLDGFDKEVPNFEVELELEDMDL
PVLKTSTTWDRDSTSLRSCFPSAIASSKTSSCTDTATGDLKYFFSDIEGEAEECLGVSTR
PYTDEQDTIASTSHMTLQLALSNAVSDVSTGIFNAVDRLRSHTRSASMPSSPRLFSDQYN
RGFARSDDNSKVGWSAGSSRLQSLNEGLQEKTTHAYDKSGSANINSFTSGRGIDDFTVCD
TEFVEFPLDFENPSSPVRVEDEGSSFRIEDDVSVMSSDSCSDFQALAVASAADTSLFTFA
DEEDYESDEM
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgcagactgaggaacgttttctcaaaatgggtgttgattgcgactcttttccaagtaga
cttggtttaccctctaatcacccgttaggccagccccgtagtaggtcatcatctaatcgg
ttggtgctggagcgacgtcaagaaacccaatccctccggaaccaagcgatcttgaaggct
tcagagaaggccttgagggagcgaaatcccgagtgttatgagcccaggcaatcctcaaat
ccgaagtcgttactatcccttcacaccacgtcactctcggactttccgtcaccacctttg
ccagttgcaaaatccaagcatttatcaaggtctgccaccttctcatcccttgagtcgaag
actgagagaaacctccattcggattatctctctgaccgatcttcttttgtcaagcttccg
ttgtctggttcagggtctgatacagggtccaacaccttgaagccttcagagaaagaacca
agtcttccaagctcatctcaacaggctactagagcagatgggccagaaatgtctgttaaa
tccctttttagatcctcctcgtttacatctaatcgggtccccatagtggactcgagtgat
tctcagcctactgaagctccttcagtagctactgcttcggaacctatgtcatccatcaaa
tcattttttaggtcatctagttttgtgcacaagtcgcaagaaatttcgagccctattgcg
aagtctctctcacggtcgctgtcgagcctctcaaaccatggccaagaatctgcgaaggag
cagaaagcggattcatcttctggattttccaaatgggcacggagctttcggttcaaacct
accgcagatgtaggtgttgagatctctgagtcctcgccatacagtcttttctcagggcca
tctggaaagcgggcatcagccaaagtgtctccaatcgaggggtttgaaaactcgttcggt
gtcctaactaagggatttatcgattcctccagaaacgctgttaaggctgttcaagacaag
gcacggcatctcgtgtcccagaataagcactggtaccaggatggccaggtccagcttgat
atagcgtacattaccgaaaatataatcgctgtgggatttccgggtgccgagagcagttcc
aacattcttggtttcgctgagggtaattaccaaggccatttagaggagctcgtcacgttc
tgcgagaaccagcatccgggcaagtacaaaatcttcaacttgtgttcagagaagctctac
gatgcctcatttcttcatgacaaggtggcgtattttcccattcgtggcaataattgtcct
ctgaagctcttgtcagcattttgtgaggctgcatatacatggctcaaggaaggccttgag
aatgtggcagtggtccactgtaagggagggatggagcgtactgggcttatgacatcctgt
cttctccttcatctcagatttttccccagtgcagaagaatcaataaaccattacaacttg
aaacgatgtgcgggtagtagctgtttagaacttcccagccagcttcgatacgtgaaatac
tatgagcaggtctccaaaaaataccatggatgtactccaactggacgaaagtgcaccttg
aggagtatacgcctcaacaactgcccagcttggattcgtccaagcgtgacagtttcagat
cataatggtgtgctgtttgcgagtaggagacatcctaatacaagtcttatgctgaccgaa
gacttatggttgagtgccatgaaatccggagtttacgtacttgagctgcctgaagacgga
catgctgctgtggttgatggggacttcaaagttcactttcagaaccgtcacgttgatttt
tcctgctggttgaactcgaatatggaagggaatatcatttttcgagtagaagacctggat
ggatttgataaggaagtacccaactttgaagtagaactggaattggaagatatggatcta
ccagttttgaaaacttcaactacatgggaccgagattccacaagcctgagatcttgtttt
ccttctgctattgcatccagtaaaacatcttcatgcactgacacagctacaggtgatctg
aagtacttcttttcagatattgaaggagaagcagaagaatgtctaggggtttcaacccga
ccatatacagatgaacaagatactattgcctcaactagccacatgacattgcaacttgca
ctgtccaatgctgtgtcagatgtcagcacaggcattttcaatgctgtggaccgattaaga
agtcacacaagatccgccagcatgcctagtagccctcggctgttttctgatcaatataac
cgtggctttgcacgatctgatgataattcaaaagttggctggtcggctggaagctctaga
ttgcaaagcttgaatgaggggcttcaggaaaaaaccacgcatgcttatgacaaaagcgga
tcagcaaatataaactcttttacttctggaagaggaattgatgacttcactgtgtgcgat
acagaatttgtagaattccctttggattttgagaaccccagttcacccgtaagggttgaa
gatgagggttcttcatttcggattgaagatgatgtgagtgtgatgtccagtgactcatgt
agtgattttcaagcgttggctgttgctagtgcagcagatacttctctcttcactttcgct
gatgaagaggattacgaaagcgacgaaatgtaa

DBGET integrated database retrieval system