KEGG   Physcomitrella patens subsp. patens: 112276234Help
Entry
112276234         CDS       T01041                                 

Definition
(RefSeq) uncharacterized protein LOC112276234
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00061  Fatty acid biosynthesis
ppp00780  Biotin metabolism
ppp01100  Metabolic pathways
ppp01212  Fatty acid metabolism
Module
ppp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    112276234
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    112276234
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppp01004]
    112276234
Enzymes [BR:ppp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     112276234
Lipid biosynthesis proteins [BR:ppp01004]
 Fatty acid synthase
  Component type
   112276234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 112276234
NCBI-ProteinID: XP_024363131
LinkDB All DBs
Position
23
AA seq 248 aa AA seqDB search
MEPLRCATGSSSSSLSSVVSASKASFCGGNVGGRNLVALRSVGTNACFPRRSLSVVRAVD
GNSTTTTRTPSAAEEVPTSTPASSKEVEVEVPIEKRYPAFPAVLDINQIMDILPHRFPFL
LVDRVIEYNPGQSAVAIKNVTINDNFFPGHFPQRPIMPGVLMVEAMAQVGGIVMLQPDVG
GSKETFFFAGVDKVRFRKPVIAGDTLLMKMKLTKLNKRFGVAKMEGQAFVGGELVCEGEF
MMALGKAE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggaacccctgcggtgcgccactgggtcatcgtcctcgtcgttgtcgtcggtagtttcc
gcgtcgaaggcatcgttctgtgggggaaatgtgggtgggcggaatctcgtggcgttgcgg
agcgttggcaccaatgcgtgtttcccgaggcggagcttgtcggtggtcagagccgtggat
gggaattcgaccacgaccacgaggaccccctcagcggcagaagaggtccccacttccacc
cctgcatcatccaaggaggtggaagtagaagttccaatcgagaagaggtaccctgcattc
cccgccgtgttggacatcaatcagatcatggacatcttgccgcataggttcccgttcctg
ttggtggaccgggtgattgagtacaatcctgggcagtcggctgttgccattaagaatgtg
actatcaatgacaatttcttcccgggccacttcccccagcggcccatcatgcccggtgtg
cttatggttgaggctatggcgcaagtaggaggtatcgtgatgttgcaacctgatgtgggg
ggctcaaaggagactttcttcttcgctggagtggacaaagtgcgcttccggaagccagtc
attgcgggtgacaccctactgatgaagatgaagcttaccaaactgaacaagaggttcggt
gtcgcaaagatggagggccaagcctttgtaggtggcgaattggtgtgtgaaggagagttt
atgatggcgctgggtaaagctgagtag

DBGET integrated database retrieval system