KEGG   Physcomitrella patens subsp. patens: 112278701Help
Entry
112278701         CDS       T01041                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein MFP2-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00071  Fatty acid degradation
ppp00592  alpha-Linolenic acid metabolism
ppp01100  Metabolic pathways
ppp01110  Biosynthesis of secondary metabolites
ppp01212  Fatty acid metabolism
Module
ppp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112278701
   00592 alpha-Linolenic acid metabolism
    112278701
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     112278701
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     112278701
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     112278701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 112278701
NCBI-ProteinID: XP_024368113
LinkDB All DBs
Position
2
AA seq 808 aa AA seqDB search
MSSQCVRRTSLSTTVAKQRERKKKGHGSVKQVACLLIHFSPKLFARQDRISEFYCCDNIL
QVEKLNQIKGREVELWFCFSRGYFVGEAMTLSVKMDVGADAVAVITIDNPPVNSLAIPAL
IALKERYNEANARDDVKAIVVTGANGKFSGGFDISVFPKLQEGGSNGYLNQASVDLMIET
IEEASKPTVAAVPGLALGGGLELAMSCHARIATPKAQLGLPELQLGILPGFGGTQRLPRL
VGLTKALEMMLLSKPIASEEGKKLGLVDEIVAPEDLLTIARRWALDIALGKRPRLSSLQR
TDKLESLGDAREIIKFARAQVKKTAPNLTHPLLCLDAVEEGVVAGGYRGALKEAELFAAT
VVSDNAKGLVNLFFAIRATSKVPGIVELGLKPRKIKKVAVVGGGLMGSGIVTALILSGYS
VLLKEINDKFLQAGLERIKANLQSRVKKGKMSREKFETILSLVTGVLTYEDFKSVDVVIE
AVIENIDLKQSIFVDLEKNCRTDCILSTNTSTIDLNVLGAKTRSQDRIIGAHFFSPAHIM
PLLEIVRTDKTSPQVIVDLMALGKAIKKTTVLVGNCTGFAVNRVFFPYTMAAMMLSDLGV
DIYRIDNAIKSWGMPMGPFRLTDLVGFGVGVAVGTQVVNSFSDRVYISRLVPKMLQSQRL
GEQNGKGFYIYDEKRKARPAPEIKDIIKESQEEAGIMLDGKPLELTDKDIVEMVMFPVVN
EACRVLAEKIVVQASDLDIASVFGMGFPPYRGGIVCWADIIGAKYIASRLNTWTKAHGDF
FKPCAFLEERASSGVKLSVPIRNSMSRL
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgagttcccagtgtgtgaggagaaccagccttagcaccactgtagccaagcagagagaa
agaaagaaaaagggccatggcagtgttaagcaggttgcttgtttgctgattcacttttct
ccgaagctcttcgcacgccaggaccgtattagcgagttctattgttgtgataacattctt
caggttgagaaattaaaccagattaaaggtcgagaggtggagctttggttctgtttttcc
cgtggatacttcgttggtgaagccatgacgttgagcgtcaaaatggatgtcggagcggac
gcggtagctgtaatcacaatcgacaacccacctgttaactcattagcgattcccgcgctg
atagccttgaaggagaggtacaatgaggcaaatgcaagagatgatgtcaaggccattgtt
gtcacaggagctaatggaaaattttctggcggttttgacatttcagtatttccaaaactg
caggagggtggttcgaatggttacttgaaccaagcatcagtggaccttatgatagaaaca
attgaagaggccagcaagcccacagttgcagcagtaccaggattggctcttggtggtggg
ttggaattagcaatgtcatgtcatgcacggattgcgacccctaaagcacagcttggactt
cccgagcttcagctgggcattcttcctggttttggtggaacgcagcggttgccacgtttg
gttggtctgacaaaagccctcgaaatgatgctgctatcaaaacctattgcttcagaggaa
ggcaagaagcttgggcttgttgatgagatagttgctccagaagacctcttgaccattgca
cgtcgatgggcacttgacattgccttaggaaagaggcctcgcttgtcttctctacagcgc
acagacaagctagaatctttgggtgatgctcgggaaatcatcaaatttgcccgagctcaa
gtcaaaaaaactgcgcctaatctgactcatcctctattatgtcttgatgctgtggaggaa
ggagtggttgctggtggttatcgtggtgctttaaaggaagccgaattatttgcagctacg
gtcgtctcagacaacgccaagggccttgtgaatctgttctttgctataagagccacaagt
aaagttccaggaatcgtcgagttgggtttaaagccaagaaagataaagaaagtggcagtt
gttggaggaggacttatgggttctggaatcgttactgcattgatattaagcggatattct
gttcttctgaaagaaatcaatgataaatttttacaggcgggacttgagcgcataaaagca
aaccttcagagtcgtgtgaagaaagggaaaatgtcccgagaaaagttcgagacgatatta
tcacttgtgacgggtgtcttgacctatgaagactttaagagtgtggatgtggtgattgag
gctgtgattgaaaatatcgatctcaagcaatcgatatttgtcgatctggagaagaactgt
agaactgactgtattctatccaccaacacatctactattgatctgaatgttctgggtgct
aaaacacgctctcaagatcgcatcattggtgcacactttttcagccctgcacatatcatg
cctcttttggagattgttcgaacagacaagacgtcaccgcaagtcatagtggatctcatg
gccctggggaaagccatcaagaagacaacagtccttgttggaaactgcacagggtttgct
gtaaatcgagtcttcttcccgtacaccatggcagctatgatgctctctgaccttggggtc
gacatttatcgtatagataatgctatcaagtcttggggcatgccaatgggaccattcaga
ctgacagatttggtcggttttggagtcggggtggcagttggtactcaagtcgtgaactcg
ttctctgatcgagtatatatttctcgactggtgccaaaaatgttgcaatctcagcgattg
ggagaacaaaacggaaaaggattctacatttatgatgagaagcgaaaggctcgtccagca
cctgaaattaaagatatcatcaaagaatctcaagaggaagctgggatcatgctcgatggc
aagcctttggaattgaccgataaagacatagtggagatggttatgttcccagtcgtgaat
gaagcttgccgtgtgttggctgagaagatagttgtgcaagcctctgacttggatattgcc
tcggtttttggcatgggctttcctccatacaggggtggcatcgtttgctgggcagatata
attggggctaagtatattgcctcaagactgaacacgtggacaaaagcccatggcgacttt
tttaagccctgtgctttcctggaggagcgcgcctcaagtggtgtcaaattgagcgtccca
attcgtaattccatgtctcgcctgtaa

DBGET integrated database retrieval system