KEGG   Physcomitrella patens subsp. patens: 112279018Help
Entry
112279018         CDS       T01041                                 

Definition
(RefSeq) SWI/SNF complex subunit SWI3A-like
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
ppp  Physcomitrella patens subsp. patens
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ppp03021]
    112279018
   03036 Chromosome and associated proteins [BR:ppp03036]
    112279018
Transcription machinery [BR:ppp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     112279018
Chromosome and associated proteins [BR:ppp03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    112279018
   PBAF complex
    112279018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM SWIRM-assoc_1 Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_7 UPF0167 SWIRM-assoc_3
Motif
Other DBs
NCBI-GeneID: 112279018
NCBI-ProteinID: XP_024368819
LinkDB All DBs
Position
2
AA seq 662 aa AA seqDB search
MVNPASVPTGLSKVRREREEENAGVDVPSKKSRKAGQSGVPEPTPEAGNQIASGKGEDEN
NGTLEENAEGAPQENAEISHKSDPASVEPSAIPTATPEAATRPEAPTQEVYRIPSYAAWF
RWDKIHPLEKRAMSEFFDKRSAAKTPRIYKEYRDFIINKYRENPKQALTFNEVRRMLSGD
VNSLSRVFEFLEHWGLINQHFSLDQAASEAPSPSLSVMDSFPSRLNVISMPVMNAARSSG
ISTFESSGHSISGTHANNLATHRNVFSPASKKVGTRFVDGHKTPDEELRCQSCKKECSKQ
RFYRKQQPGSNFCPDCVKKGKLPPGSSSSDFLQATDGEATVATKEWTSKETLLLLEAVSR
FGENWNQVAAHVPTRSKSECVKHFIELPFGDSYSVEPEEPKATRVAGSGAAENDELVMSE
GTTEAALSDSTAANGIAPPESTCEATQHAEGNVVTAAHDLVSPFTDTSHPLFAQVVLLSG
MVGPRVAAAAAQAAVAAIAEDEPGVLELPFMQRSRMVSGQKKHASQTTQNHAESLVEDRN
DELQCNGDGPPRAKPGASSEELPSAVQARVGVATALGVAAANAKLLADQEEREIEHLVAS
IIDNQMKKLYTKLEHFEELEMLLEKERLEVERARQQVYADRLRYAEAQTASAKSLLRNPA
PS
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacccggcgagcgtgcctacggggttgtccaaagtgaggagggagagggaagag
gagaacgcgggtgtggatgttccgagcaagaagagcaggaaagctgggcagagcggagtg
ccggagcccactcccgaagcggggaatcaaattgcgtcggggaaaggagaggatgaaaac
aatggaacgttggaagagaatgcagagggggctccccaagaaaatgcagaaattagtcac
aagagtgacccagcttccgtggaaccatcagctatacccacagccactccagaggctgcg
acccggcctgaagcgcctactcaagaggtgtacagaatacccagctatgcagcttggttt
cgttgggacaagattcacccattagagaaacgagcgatgagcgaatttttcgataagaga
tcagccgcaaaaacaccgagaatctacaaagagtacagggatttcataataaacaagtac
agggagaatccaaagcaggctctaacgttcaatgaagtgcggcgcatgttgagtggtgat
gtgaattctttgagtcgagtgtttgaatttttggaacactgggggctgattaaccaacat
ttttcgttggatcaagccgcgtcagaggcgccttctccgtcgctgagtgtgatggattct
ttcccaagcaggctgaacgtgatcagtatgcccgtgatgaatgctgcaagatcgtcagga
atatccacatttgaatcatcaggtcactctattagtggtacccatgcgaacaatcttgct
acccacaggaacgttttctcgcccgcaagtaagaaagtgggaactcgttttgtggatggg
cacaagacaccagatgaagaattacgttgtcagtcgtgtaaaaaggagtgctcaaagcaa
cggttctataggaaacagcaacctggatccaatttttgcccggattgtgtgaagaaaggc
aagctaccaccaggcagttcgtcaagcgactttctgcaagcaacagacggcgaggcaact
gttgcaactaaagagtggacaagcaaggagacattgcttcttcttgaggccgtgagccgc
tttggagagaactggaatcaggttgctgcgcatgtgcccacgagatcgaaatctgaatgt
gtgaaacatttcatcgagctgccatttggagacagctacagtgtggagcccgaagagcca
aaggccactcgtgttgccggttctggagcagccgagaatgatgagttagtaatgtctgag
ggcacgacggaggctgccttgagcgatagcacggcggcgaacgggatagctccacctgag
agtacctgtgaagcaacacaacatgcagagggcaatgttgtaactgctgcacatgactta
gtgtctccattcactgacacaagtcatccactttttgctcaggtagtattgctttcagga
atggtagggccacgggttgcagcagcggcagcacaggcagctgttgcagcaattgcagag
gatgagccaggggtgttggagctgccgttcatgcaaaggtcgagaatggtttcaggtcaa
aagaagcatgcatctcaaactacacagaatcatgccgagagtttggtggaggatcgcaat
gatgaactgcagtgcaacggcgatggtccaccacgagcaaagccaggtgcaagcagtgag
gagttgccatctgctgttcaagcacgggttggcgtggccacagcactgggcgtggctgct
gcaaatgcaaagctgctagctgatcaggaggagcgggagattgagcatctggttgccagc
atcatcgataatcagatgaagaagctgtacactaagctagagcattttgaggagttggag
atgctgttggaaaaggaacgtctggaggttgagcgagcacgacaacaggtatatgcggat
cgtttacgttatgcggaagctcaaacagcaagcgcaaaatcgttgctaagaaaccctgcg
cccagttga

DBGET integrated database retrieval system