KEGG   Physcomitrella patens subsp. patens: 112279806Help
Entry
112279806         CDS       T01041                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00010  Glycolysis / Gluconeogenesis
ppp00020  Citrate cycle (TCA cycle)
ppp00620  Pyruvate metabolism
ppp01100  Metabolic pathways
ppp01110  Biosynthesis of secondary metabolites
ppp01200  Carbon metabolism
Module
ppp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112279806
   00020 Citrate cycle (TCA cycle)
    112279806
   00620 Pyruvate metabolism
    112279806
Enzymes [BR:ppp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     112279806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Redoxin
Motif
Other DBs
NCBI-GeneID: 112279806
NCBI-ProteinID: XP_024370296
LinkDB All DBs
Position
3
AA seq 488 aa AA seqDB search
MATSLHLSLAASAPASALRSSSAFFGNAGSLSRPSVVLGIGRRNANLVVEAKIREIFMPA
LSSTMTEGKIVTWNKTEGEKLTKGESVVVVESDKADMDVETFYDGFLAKIVIGEGETAPV
GAAIGLLAETEEEIAEAKSKGAAQAAPAAPKPSAVEEKAVAPPAPTAAPAVAAVQVAPEP
TAPEEPRSSRIVATPYAKKLAKQYSVDLATIAGSGPSGRIVAEDVEAAAGKTPVPAAAPV
PSVAQPSAAVAAAPSAAPTPAAALAPAGSVAFTSMQAGVARNMVDSMSVPVFRVGYTITT
DALDALYKKIKSKGVTMTALLAKAAALALAKHPVVNACCKDGKSFTYNEDINIAVAVAMD
GGLLTPVLKNADKVDIYSLSRSWKDLVDKARAKQLSPAEYNSGTFVLSNLGMFGVDRFDA
ILPPGMGAIMAVGASVPTVVATGNGLFGVKNRMTVNVTADHRIIYGGDLAVFLQTFAAII
EDPTELTM
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctcgctgcatctttcgttggctgcctcggcgccggcatccgccctgaggagc
tcgtcggcgttctttggaaatgctgggagccttagtcgcccatcggtggtgctcgggatc
gggaggaggaatgcgaacctcgtagtggaggctaagattcgggagatttttatgcctgct
ctgagctctaccatgacggagggcaagattgtgacgtggaataagaccgagggcgagaag
cttaccaaaggtgagagcgtggtggttgtggagtctgataaggccgacatggatgtggag
acgttctacgacggctttcttgccaaaattgtgattggggagggagagacagcacctgtt
ggagctgccattggactgcttgctgaaacggaggaagagattgccgaagctaagtccaaa
ggagccgcgcaagcagctcctgctgctccgaaaccctcagctgtagaggagaaggctgtg
gcaccacctgctccaactgccgcacctgctgtagcagctgtccaggtcgctccagagcct
actgctcccgaggaacccaggtcgagtagaattgtagcaaccccttatgccaagaagctt
gcaaagcagtacagcgttgatcttgctaccatagcaggctctggaccttcgggtcgtatt
gttgccgaggatgtggaggctgctgctggcaagacccccgtccctgctgctgctcccgtc
ccatccgtggcccaaccttcggctgcggttgctgctgctccctccgctgctccaactcct
gccgcagccctcgcccctgctggttctgtagcattcacgtcaatgcaggctggtgtggcc
cgtaatatggtggacagcatgtccgtccctgtgttccgcgttggttacactatcaccact
gatgcgcttgacgccctctataagaagatcaagtcgaagggcgtgacgatgactgcactt
cttgctaaggctgctgcccttgccttggcgaagcatcccgttgtcaatgcttgctgcaaa
gatggcaaaagtttcacttataacgaagacatcaacattgccgttgccgttgcaatggac
ggtggtctgctcacaccagtcttgaagaatgcagataaggtggatatttactcattgtct
cgctcatggaaggatcttgttgacaaggcccgcgccaagcagctttcaccagcagaatac
aattcaggcacatttgttctgtcgaaccttggaatgttcggggtagaccggtttgatgcc
atattgccccctggcatgggtgcaattatggcagttggcgcgtctgttcccacggtagtt
gccacagggaatgggctatttggcgtgaagaatagaatgacggtgaacgtgaccgctgac
cacagaatcatctatggtggagacctagctgtgtttctgcaaacctttgcagcaatcatt
gaggaccccacggagctaaccatgtga

DBGET integrated database retrieval system