KEGG   Physcomitrella patens subsp. patens: 112281303Help
Entry
112281303         CDS       T01041                                 

Definition
(RefSeq) uncharacterized protein LOC112281303
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112281303
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppp02000]
    112281303
Enzymes [BR:ppp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     112281303
Transporters [BR:ppp02000]
 Other Transporters
  Pores ion channels [TC:1]
   112281303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C_5 Glutaredoxin GST_C GST_N_4 GST_C_3
Motif
Other DBs
NCBI-GeneID: 112281303
NCBI-ProteinID: XP_024373430
LinkDB All DBs
Position
4
AA seq 492 aa AA seqDB search
MRSPVGSLVACAIPVSRLSVSSISAAASRHQQLDTGKSIKLHLNTKLQSSLVKWKSRAAF
EGRVSGEHRRCERVVRLTAMEASVESSEGKKTTLASWDALAGIVGNDEDFPERLPNMKRR
VFEDGQKLLLTFYRDNSSWCPYCQRVWLQLEEKKIPYQVEKINMRCYGDKPAWFTKMVPS
GLLPVIELDGRIITESMDIMILIEKRFPEFNPLLPAGGPELAAVNSLLGLERRLAGAWMN
RLRSSWPDMGAFENTMDKVNSALQTFGGPYFLGSKFSLVDAVYAPFLERTAASMPYWPGV
KVRGNDRWNAVNLWFDAMDSRPSYQAMKSDDFTHTHDLEPQIGPCYSAPAGKAYRDKIDG
KDGGWELPLKPEETAWGFDDGTGKGGAKEEAARTLISNHEKVVGFALRGVNDGDKHRDAM
GHGLHLVANALVQGVENLDGFVTPDTLPPQVAVAAAYLRDRVGVPRDLSYPAARQLRAHL
NWLIRSLGRPDL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcacctgtgggatcgctggttgcctgcgccattccagtttccaggctttctgtc
tcatcaatttcagctgcagcgtccaggcaccagcaacttgatacagggaaatcaatcaag
cttcatctcaatacgaagttgcaatcgagtcttgttaagtggaaatcccgagcggcattc
gaagggcgtgtttcaggagagcacagaaggtgtgagagagtggtgaggctcacagctatg
gaggcatctgtagagtcgagtgagggaaagaagacgaccttggcatcttgggatgctctt
gctggaatagttggcaatgacgaggattttcctgagcggctacccaatatgaagagaaga
gtatttgaggatgggcagaagctgcttcttacgttttacagggataactctagctggtgt
ccatattgtcagcgggtgtggctacagttggaggagaagaaaataccttatcaggtggag
aagatcaatatgagatgttacggtgataagcctgcctggtttacgaaaatggtgccttct
ggtttgctgccagtaatagagcttgacgggaggatcatcacggagagcatggatattatg
attctgatcgagaagaggtttccagagtttaatcctttgttaccggctggcggaccagag
ctggctgcagtgaattcattgttagggttggagaggcgtttggcgggtgcatggatgaat
cgtttgcgaagctcctggcccgatatgggtgcgtttgagaacaccatggacaaagtgaac
tcggcattgcaaacatttggcggaccctacttcttgggcagtaagttttctctggttgat
gcggtgtatgcgccattcctggaaagaacagcggcaagtatgccctactggccaggtgtg
aaggtgcgaggaaatgatcggtggaatgctgtgaacttgtggtttgatgccatggactcc
cgaccttcatatcaagccatgaaatccgatgacttcacccacactcacgatctggagccc
caaattggtccatgctattcagcaccagctggcaaagcttacagagataagatcgatggg
aaagatggggggtgggaattgccgctaaaacctgaagagacagcctggggattcgacgat
gggactggaaaagggggagccaaggaagaagcggcgaggaccttgatctctaatcacgaa
aaggtggtcggttttgcactacggggagtgaacgatggtgacaagcacagggacgcaatg
ggtcatgggcttcatcttgtagcaaacgcgcttgtgcagggtgtagaaaacctggatggg
tttgtcactcccgacactctcccaccccaagttgccgttgcagcagcatacttgagagac
agagtcggtgtccctcgtgatctttcctacccagcagctcgacaactgcgagctcatctc
aactggttaatacgttctttaggccgtcccgatctgtag

DBGET integrated database retrieval system