KEGG   Physcomitrella patens subsp. patens: 112281305Help
Entry
112281305         CDS       T01041                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00010  Glycolysis / Gluconeogenesis
ppp00053  Ascorbate and aldarate metabolism
ppp00071  Fatty acid degradation
ppp00280  Valine, leucine and isoleucine degradation
ppp00310  Lysine degradation
ppp00330  Arginine and proline metabolism
ppp00340  Histidine metabolism
ppp00380  Tryptophan metabolism
ppp00410  beta-Alanine metabolism
ppp00561  Glycerolipid metabolism
ppp00620  Pyruvate metabolism
ppp00903  Limonene and pinene degradation
ppp01100  Metabolic pathways
ppp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112281305
   00053 Ascorbate and aldarate metabolism
    112281305
   00620 Pyruvate metabolism
    112281305
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112281305
   00561 Glycerolipid metabolism
    112281305
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    112281305
   00310 Lysine degradation
    112281305
   00330 Arginine and proline metabolism
    112281305
   00340 Histidine metabolism
    112281305
   00380 Tryptophan metabolism
    112281305
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112281305
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    112281305
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     112281305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 112281305
NCBI-ProteinID: XP_024373433
LinkDB All DBs
Position
4
AA seq 535 aa AA seqDB search
MAAMAMARGKARTLLSTALRATSAGPARLHRNFCAAAAAEELENPTIAPVEVKLTKLLID
GEFVDAASGKTFPTIDPRSEQVIAHVAEGDVEDVNRAVRAARKAFDHGPWPKMPPFQRQR
ILLKYADLLDQHADELAALETMDSGKPYEQARYAELPLMSRQFRYFAGWADKIFGTTGPS
DGIHAVQTLHEPIGVVGQIIPWNFPLVMYCWKVAPALAAGNTIVLKTAEQTPLSAILAGK
LALEAGIPPGVLNIVSGYGPTAGASIAEHMDIDKVAFTGSTEVGKLVMAAAARSNLKPVT
LELGGKSPMIICEDANVDEAVELAHFALFFNMGQCCCAGSRTFVHESIYDEFVEKSKARA
LKRVVGDPFRKGVEQGPQVDKDQFHKVLGYVESGMEQGANLITGGGRLGSKGYYIKPTIF
TDVKEGMKIFDEEIFGPVQSIAKFKTLDEVVQRANNTVYGLAAGIFSNNINTVNTLSRAL
RAGTIWVNCFDVFDATIPFGGYKQSGIGREKGKYVLESYTQVKAVVTPLHNPAWL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatggcgatggccagaggcaaggcgaggacgctcctgtcgacggccttgcgc
gctacttcggctggccctgctcgcctgcatcgaaatttctgtgcagcggcagcagctgag
gagctggagaatccgaccatagctcccgtggaggtcaagcttacgaagctgctcattgat
ggggagtttgtggacgcggcctcagggaagacgttcccgaccatcgacccaagaagcgag
caagtgattgcccacgttgctgagggagatgtcgaagatgtcaaccgcgctgtgagagct
gcccgcaaggccttcgatcatggaccctggccgaaaatgccccctttccagcgccagcga
atactcctcaagtacgcagatttgctcgaccagcatgcggacgagctcgcagcgctggaa
acgatggactctggaaagccctatgagcaggcccgctacgccgagctccccttaatgtcc
cgtcaattcagatacttcgctggttgggctgacaagatcttcggcacgacggggccgtca
gacggaattcacgccgtccagacactccacgagcctattggagttgttggacagatcatt
ccgtggaatttccccttagttatgtactgctggaaggtggcgcccgctttggcagccggt
aacactattgtgttgaagacggcggagcaaacgcctttgtctgccatccttgcagggaag
ctggccctggaagctggcattcctccgggcgtgctgaacattgtctccggatatggcccc
actgcgggtgcctccatcgctgagcacatggacatcgacaaagtggccttcacggggtcg
acggaggtcgggaagctcgtcatggctgctgcagcgcgcagcaacttgaagcccgtgacc
ctggagctcggaggaaaatcgcccatgatcatctgtgaagacgcaaacgtggacgaagcg
gtggagcttgcccatttcgctctgttcttcaacatgggtcagtgctgttgcgctggctct
cgcacctttgtccatgagagtatctacgacgagtttgtagagaaatccaaggcgcgcgca
ttgaagcgcgtcgtcggtgatccgttcaggaagggcgtggaacagggtcctcaagtggac
aaggaccagttccacaaggtgctcggatatgtcgagagcggcatggaacagggtgccaac
cttatcacaggtggaggtcgtttggggagcaagggctactacatcaagccaaccatcttc
accgatgtgaaagaaggcatgaagatcttcgacgaggagattttcggacccgtccagtcg
atcgcaaagttcaaaaccttggacgaagttgtgcagcgtgccaacaacacagtctacggt
ctggctgccggcattttcagcaacaacatcaacaccgtgaacactttgagccgggcattg
cgagcgggaaccatctgggtcaattgcttcgacgtcttcgacgccaccatccccttcggt
gggtacaagcagagcggcatcgggcgggagaagggcaagtacgtgttggagagttacacg
caagtgaaagcagttgtgacgcctctgcacaacccagcttggctataa

DBGET integrated database retrieval system