KEGG   Physcomitrella patens subsp. patens: 112283304Help
Entry
112283304         CDS       T01041                                 

Definition
(RefSeq) microsomal glutathione S-transferase 3-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112283304
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppp02000]
    112283304
Enzymes [BR:ppp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     112283304
Transporters [BR:ppp02000]
 Other Transporters
  Pores ion channels [TC:1]
   112283304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 112283304
NCBI-ProteinID: XP_024377614
LinkDB All DBs
Position
6
AA seq 173 aa AA seqDB search
MGSFMGLKMPTSFSAAPLIGAGGARMAPVVAAGFTVAPEFGYVVLTASASVILTQWQMFQ
VAFQRRRSGLKYPKMYEDAEDSLFNCYQRAHQNTLESYPAFLTLLVISGLAYPITASVFG
MLWVVGRVVYSLGYYTGDPSKRFRGAFHNFGLWGLLVTSIVFGVRTVMPLLSA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgtttatgggattgaagatgccaacaagctttagcgctgcacctctgattggc
gcaggaggagctcgtatggcgccagtagtggctgctgggtttacagtggcgccggagttt
gggtacgtggttttgactgcttctgcgagcgtcatcctcactcaatggcagatgtttcag
gtggctttccaaaggaggaggagtggtttgaagtatcctaagatgtacgaggacgcagaa
gattctctgttcaactgttaccagcgagcacatcagaacactctggagagttaccctgcc
ttcttgacattacttgtcatctccggacttgcttacccaattaccgcttctgtatttggc
atgctttgggtggtcggacgcgtggtctactccctcgggtattacactggagacccttcc
aagagattcaggggcgccttccataacttcggattgtggggcttgctggttacatccata
gtgtttggagtccgcacggtgatgcctctcttgtctgcttaa

DBGET integrated database retrieval system