KEGG   Physcomitrella patens subsp. patens: 112283658Help
Entry
112283658         CDS       T01041                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00020  Citrate cycle (TCA cycle)
ppp00190  Oxidative phosphorylation
ppp01100  Metabolic pathways
ppp01110  Biosynthesis of secondary metabolites
ppp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112283658
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    112283658
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     112283658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 FAD_binding_3 Thi4 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 112283658
NCBI-ProteinID: XP_024378458
LinkDB All DBs
Position
6
AA seq 634 aa AA seqDB search
MLRRVVEKSGSATRRLLREQNGAVAARRFQQPRRGLAVDAKSYPLVDHTYDAIVVGAGGA
GLRAAIGLSESGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
LGDQDAIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLNFGKGGQAYRCAAA
ADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDDEGACRGVTALNMEDGTLHRFRAAN
TILATGGYGRAYFSATSAHTCTGDGNAMAARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEKDHIYLHLNHL
PPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTKKGNDPDC
MIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEKFKPGQSQPELPKDAGE
KTIAWLDKLRYANGDLPTSEIRNRMQRTMQNNAAVFRTQETLEEGCKLIDETVDSFSRVK
INDRSLTWNTDLIETIELENLLINASITMHSAEARKESRGAHAREDFSVRDDEKWMKHTL
GFWDENRVKLDYRPVHMNTLDDEVETFPPKARVY
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggcgggtggtggagaaatcggggtctgccactaggcggttgttgcgcgagcag
aatggtgcggtggcagcaaggcggtttcagcagccgaggcgtggtttagcagtggatgct
aagtcgtatccgctagtggaccacacatatgacgccattgttgttggagcgggaggggct
gggcttagggcagccattggtttatccgagagcggattcaacactgcttgtatcacaaag
ctttttcccacgaggtctcacacagttgcggcacagggtggtattaatgcagccttggga
aacatgactgaggatgattggaggtggcatatgtatgacactgtgaaaggcagtgattgg
ctcggtgatcaagatgccatccagtacatgtgtcgggaagctccaaaggcggtcattgaa
ttagaaaattatggactcccgttctcgcgtactgaggaagggaagatctaccaacgtgct
tttgggggtcagagcctgaattttgggaaaggtggtcaagcatatcgatgtgcggctgca
gcggatcgcactgggcatgccatgcttcacaccttgtatggtcaagccatgaagcataac
actcagttttttgttgagtattttgctcttgacctgatcatggatgatgaaggtgcctgc
agaggagtgactgcattgaacatggaggatggtactcttcaccgcttccgtgcagcgaat
acgattcttgcaactgggggttacggacgagcatatttctcagctacgtctgcgcataca
tgcactggcgatggtaatgccatggctgctcgggctggcttgcctctacaggatttggag
tttgtccagtttcacccaactggaatctatggagctggctgtctcatcaccgaagggtct
agaggagaaggaggcatcttacgaaacagtgagggagagaggtttatggaaagatatgcg
ccaactgcgaaggatttggcatctcgagatgttgtgtcacgatcaatgacaatggaaatt
cgtgaaggacgtggtgttggacctgaaaaggatcacatttatcttcacctgaaccacttg
cccccagaagtgttaaaggaacgtcttcctggaatttcggaaactgctgccatttttgct
ggtgtagatgtaacgaaggaacccattcctgttctaccaactgtacattacaacatgggt
ggtatccctaccaaccaccatggcgaggttgtgacgaaaaaaggtaatgatccggattgt
atgattcccgggttgatggctgctggtgaggctgcatgtgcttctgttcatggggccaat
cgactcggagccaactcacttctcgatattgtggtattcggacgagcttgtgcaaatcga
gtagccgaaaagttcaagcctggtcagtcccagcctgagctgcccaaggatgctggagag
aagaccattgcatggttggacaaactgcgatatgctaacggtgaccttccaacatcagaa
attcgtaacagaatgcagcgtaccatgcaaaataatgctgctgtctttcggactcaggag
actttggaggaaggttgcaaattgattgatgaaaccgtggattctttctctcgcgtcaag
atcaatgatcgcagtctaacttggaacactgacttgatcgaaacaattgagttagagaac
ctcttgattaatgcctcgatcactatgcactcggctgaggcccgcaaggaaagtcgtggg
gctcatgctcgtgaggacttttcggtacgcgatgacgagaagtggatgaaacacactctt
ggattttgggatgagaacagggtgaaattggactatcgtccagtccacatgaacaccttg
gatgacgaggttgagaccttcccaccaaaagctcgcgtttactag

DBGET integrated database retrieval system