KEGG   Physcomitrella patens subsp. patens: 112284309Help
Entry
112284309         CDS       T01041                                 

Definition
(RefSeq) protein cornichon homolog 4-like isoform X1
  KO
K20368  protein cornichon
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Membrane trafficking [BR:ppp04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    112284309
Transporters [BR:ppp02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   112284309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 112284309
NCBI-ProteinID: XP_024379776
LinkDB All DBs
Position
7
AA seq 156 aa AA seqDB search
MASDLLLWLICFLAVVSLLGILVYQLMCLSDLEFDYINPFDSASRINAFIVPEFLIHGAL
GCICLLSGHWLLFLLNVPLAYYHINLYLKKEHLLDVTEIFNLLDREKKYRLAKLAFYLLL
FFIVIYKLVLAAVYLILEHEESVQSAGTFSGIHANM
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgatctccttctgtggttaatctgcttcctcgccgttgtttcgttgcttgga
atccttgtttaccagctgatgtgcttgtctgaccttgagttcgattacatcaacccattc
gactccgcatcccgcatcaatgcttttattgtccctgaatttctgattcatggagccctg
gggtgcatctgccttcttagcggtcattggttgctgttcttgctcaacgttcctttggcc
tattaccatataaatttgtacctgaagaaagaacatctgctggatgtcacggaaattttt
aatcttctggatcgagagaagaagtatcggctagccaagttggcattttatctactgctc
ttcttcattgttatttacaagttggtgttggcagccgtctacttaattcttgagcatgag
gaatctgtccagtcagctggaactttctcggggatccacgcaaacatgtga

DBGET integrated database retrieval system