KEGG   Physcomitrella patens subsp. patens: 112287048Help
Entry
112287048         CDS       T01041                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112287048
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     112287048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 112287048
NCBI-ProteinID: XP_024385428
LinkDB All DBs
Position
9
AA seq 206 aa AA seqDB search
MAATAMAMSTLSTSLVAPTVAASQSAFQGASVRINHMPALGIVKSRPLTIVAATKKAVAV
LKGNASVEGVVTLLQEDDGPTKVNVKITGLTPGKHGFHLHEFGDTTNGCMSTGPHFNPEG
KTHGAPEDDNRHAGDLGNVIAGNDGVVEVTLEDSQIPLSGPHSVVGRAFVIHEAEDDLGK
GGHELSSTTGNAGGRLACGVVGLTPL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgacggcgatggccatgtccacgctctctacatctctcgtcgctcccactgtg
gccgcgtcacagtccgccttccagggtgcatctgtgcgtatcaaccacatgcctgctttg
ggtattgtcaagagccgccccctcaccattgtggcagctaccaagaaagccgtggctgtg
ctcaagggcaatgccagtgttgagggcgttgtaactcttctccaggaggatgatggtccc
acaaaggtcaatgtaaagatcactggcttgactcccggcaagcatggattccatctccat
gagtttggtgacacaaccaatggctgcatgtctactggtcctcactttaaccctgagggc
aagactcacggtgccccagaagacgataatcgacatgcaggagacttgggcaacgttatt
gctggcaatgatggcgtcgtggaggtcacacttgaggactcccagattcctctatccggt
ccacactccgtagttggaagggcgttcgtcatccacgaagctgaagacgatcttggaaag
ggtggccacgagctcagctctacaaccggcaacgcaggaggacgacttgcttgcggtgtt
gtgggtctaacacctctgtaa

DBGET integrated database retrieval system