KEGG   Physcomitrella patens subsp. patens: 112290811Help
Entry
112290811         CDS       T01041                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp03030  DNA replication
ppp03410  Base excision repair
ppp03420  Nucleotide excision repair
ppp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    112290811
   03410 Base excision repair
    112290811
   03420 Nucleotide excision repair
    112290811
   03430 Mismatch repair
    112290811
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppp03032]
    112290811
   03400 DNA repair and recombination proteins [BR:ppp03400]
    112290811
Enzymes [BR:ppp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     112290811
    6.5.1.6  DNA ligase (ATP or NAD+)
     112290811
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     112290811
DNA replication proteins [BR:ppp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    112290811
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     112290811
DNA repair and recombination proteins [BR:ppp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     112290811
   NER (nucleotide excision repair)
    Other NER factors
     112290811
   MMR (mismatch exicision repair)
    Other MMR factors
     112290811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 112290811
NCBI-ProteinID: XP_024393289
LinkDB All DBs
Position
13
AA seq 776 aa AA seqDB search
MAGKKSAFEFMMGNARKGSSKEKGCPSASLAEKAKEVIKESVKETIKEEADEKMEDISVM
DIDVKMEDKKVITSSTTDSVAPSTKEAKRKGRPPASSVAKAKQVVKESETATIKEEVDAK
MEEKKVVASTAAEAVVLLTKKETDFDPEAAAFWKPGQPVPFLFLASALDIISDESGRLAM
TNILCNVFRTVIATTPKDLLAVVTLSANRIAPAHEGVELGIGDAAIVRVLTEAYGRKADQ
IKAQMKTLGDLGLVAKASRTSQRTMFKSQPLTCAKVLDTFREIAKDSGNQSQDRKRGRMK
ALLVAATECEPLYLVRLLQSKLRIGLAEKTVLAALAHAAVLSEVPRVPANQLTARLEEAE
EIMKETYSVLPIYEKIISAILEHGIRKLPEVCNFTLGIPVGPMLAKPTTGVSEVLNKFQD
MEFSCEYKYDGERAQVHYLQGGTIEIYSRNAEHNTGKFPDIVAAMPRCMKTGTETYVLDC
EVVAYDREKNKILPFQVLSTRARKGVVLSDIKIQVCLFAFDLLYLNGRPLLKEQLNVRRE
LLYSSFQEIPGEFQFATAKNSNDLEEIQKFLEDAINDSCEGLIVKTLSKDATYEPAKRSN
NWLKLKKDYMNTGGGDSLDLVPIGAFYGRGKRVGVYGAFLLACYDEDREEFQSICKIGTG
FTEAVLEERSVTLKNHVIPQPRSYYRYGETIGVDVWFEDVEVWEVKAADLSISPVHRAAV
GLVDPNKGISLRFPRLMRLREDKTPVEATSAQQVAEMYRAQKINHGHGGDADDDDD
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atggcagggaaaaaatctgccttcgaatttatgatggggaacgcccggaagggcagttcc
aaagagaagggttgcccctcggcatcattggctgaaaaggccaaagaggtaattaaggag
tctgtgaaggagactatcaaagaggaggccgatgagaagatggaagacatttcggtgatg
gatattgatgtgaagatggaggacaagaaagtcataacctcttcaaccacagactcggta
gcgccatcaaccaaggaggctaagcgaaagggtcggcctccggcatcgtcagtagcaaag
gccaagcaggttgttaaggagtctgagacggcgaccatcaaagaggaggttgatgcgaag
atggaggagaagaaagtagtggcgtctacagctgccgaagcggtcgtgctattaaccaag
aaggagacagattttgaccctgaagctgctgcattctggaagccggggcaacccgtgcca
ttcttatttcttgccagcgctcttgatatcatttcagatgagtcagggaggctagcaatg
acgaatattttgtgcaatgtatttcggacggttattgcaaccacgccgaaggatctcctg
gcagtcgtgaccttgtcagcaaataggattgctccagctcatgagggtgtggagcttggt
atcggtgatgcggccattgtcagagtccttactgaggcgtatggaagaaaggctgaccaa
attaaagctcagatgaagacattgggggaccttggtctcgttgcaaaggctagtcgaact
tcgcagaggaccatgttcaaatcacaacccttgacgtgtgcaaaagtactggatacattt
cgcgagattgctaaggatagcggcaaccagagtcaggacaggaagcgtggaagaatgaaa
gctcttcttgtagcagccacagaatgtgagccattataccttgtccgcctgcttcagtcc
aaactacgcataggtttggcagagaaaaccgtgctagcagctctggcgcacgcagcggtg
ctttctgaggtccctcgagttcctgctaatcagctgactgctaggttagaagaggcggaa
gaaataatgaaggaaacctactcagtgcttcctatatacgaaaagattataagcgcaata
ttagaacatggtatccgcaagctacctgaagtttgcaattttactttgggtatacctgtt
ggacctatgctagctaagcctacaaccggggtttctgaagttctcaacaaatttcaggac
atggagttttcatgtgaatataaatatgacggtgaaagagctcaggtacattatctgcaa
gggggcacaattgagatatacagtagaaatgctgaacacaacactgggaagtttcctgac
atcgttgcagcaatgcccaggtgtatgaaaactggaactgaaacatatgtacttgattgt
gaagtagtcgcttacgatcgagagaagaataagatattgccctttcaggttttgagcacc
cgagctcgaaaaggggtcgtgttgagcgacatcaaaatacaagtgtgtcttttcgcgttt
gatcttctgtacctgaatggccgtccattgttgaaggagcagttgaatgttcgaagagag
ttgctgtactcctcgtttcaagagataccaggagagtttcagttcgcaactgcaaagaac
tcaaatgatttggaggagattcaaaagtttctagaagatgctataaatgacagttgtgaa
gggctaattgtgaagacattgtcaaaagacgcaacttatgaacctgctaagcgttcgaac
aattggctcaagctcaagaaagattacatgaatactggaggtggagattccttggatctt
gtaccgattggagcgttctatggtcgtggaaaacgcgtcggtgtttatggcgcgttcttg
ttggcatgttacgatgaagatcgggaagagtttcaaagcatctgcaaaattggaacggga
ttcacagaggctgtgctggaggaacgttctgtgaccctgaagaatcatgtcatacctcaa
ccgaggtcctattacagatatggggagacaattggagtagatgtttggtttgaagatgtt
gaggtctgggaggtgaaggctgctgatttgagtattagccctgtccatcgagcagctgtg
ggattggttgatcccaataaggggatttcgttgcgttttccaaggttgatgagattacgg
gaagataaaacgcctgttgaagcgacttcagcacagcaggtcgcagaaatgtatcgagct
cagaagatcaaccatggccatggtggagacgccgacgatgacgatgattag

DBGET integrated database retrieval system