KEGG   Physcomitrella patens subsp. patens: 112291391Help
Entry
112291391         CDS       T01041                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00250  Alanine, aspartate and glutamate metabolism
ppp00410  beta-Alanine metabolism
ppp00430  Taurine and hypotaurine metabolism
ppp00650  Butanoate metabolism
ppp01100  Metabolic pathways
ppp01110  Biosynthesis of secondary metabolites
Module
ppp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    112291391
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    112291391
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112291391
   00430 Taurine and hypotaurine metabolism
    112291391
Enzymes [BR:ppp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     112291391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 112291391
NCBI-ProteinID: XP_024394504
LinkDB All DBs
Position
14
AA seq 548 aa AA seqDB search
MVLSICKSMKETKGHDTIDSMFASRYAQAELPRFEIPTQETPKDVAYQIISDELMLDGNP
RLNLASFVTTWMEPECDKLIMAALNKNYIDMDEYPITTELQDRCVNMVARLFNAPIGEGE
QAVGAGTVGSSEAIMLAGLAFKRKWQLERKAAGKPWDKPNMVTGANVQVCWEKFARYFEV
ELREVTLKEDYYVMDPHRAVELVDENTICVCAILGSTYNGEFEDVQLLNDLLEKKNQELG
LNVPIHVDAASGGFVVPFIYPDIVWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDL
PEELIFHVNYLGADQPTFTLNFSKGASQVIAQYYQLIRLGFNGYKSIMTNCAMNAKILTQ
AIENLGRFKILSKEVGVPLVAFSLLDSSNYTEFDISDGLRRYGWTVPAYTMAPDAQHVTL
LRVVVREDFSRSLANRLVTDIKRVLDHFDARPPKLIEVVTAAVAQENREANLDLPTTPDA
VKATAAFNDIVVEGHHGGKKKQQHGHGHGHHGRSHSHSHHGRSHSHHHSHSKDNHGKKPA
LHKMNGVC
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggtgctatcaatatgcaagagcatgaaggagacgaagggccacgatacgattgactcc
atgtttgcctctagatatgctcaggctgagcttcctaggttcgaaattcccacccaggaa
acacccaaggatgttgcataccaaatcatcagcgatgagctcatgttggacggcaatcct
cgcttaaatctagcatccttcgtgacgacatggatggagccagagtgtgacaagctcatc
atggcggccctcaacaagaactacattgacatggacgagtacccgattaccactgagctt
caggaccggtgcgtgaacatggtcgcccgtttgttcaatgcaccaattggggaaggtgaa
caagctgtcggagctggtacagtgggatcatctgaggctatcatgctcgctggtctcgca
ttcaagcggaaatggcagcttgagcgtaaagcagctggaaagccttgggacaagcccaac
atggtcaccggtgctaatgttcaggtgtgttgggagaagttcgcaagatacttcgaagtg
gagctccgagaggtaactctcaaagaagactactacgttatggatccacacagagcagtc
gaactcgtcgacgagaacacgatatgtgtgtgtgctatcctcggatcgacgtacaatggc
gaatttgaagatgtgcagctgcttaatgatctgctagagaaaaagaaccaggaactaggg
ttgaatgttccaattcacgttgatgccgcaagtggaggtttcgttgtcccgttcatatac
ccggacattgtatgggacttccggcttccactggtgaagagcatcaatgtgagtggacac
aagtatggcctcgtctacgccggcattggctgggtcgtgtggaggaacaaggaggattta
cccgaggagcttatatttcatgtcaactacctcggcgcagaccagcctacgttcacattg
aatttctccaaaggtgcgagccaagttatcgcacaatactatcagctcattcgtctcgga
ttcaatggatacaagagtattatgacaaattgcgccatgaatgccaaaatactcacacaa
gctattgagaaccttggccgatttaagatcttatcgaaggaagtcggtgtccccttagta
gcgttctccctcttggacagcagcaactacaccgagttcgacatctccgacggccttcgt
cgctatggctggaccgtgcccgcgtacaccatggcgcccgatgcgcagcacgtcactctc
ctccgtgtcgtggtgcgggaggattttagccggtctttagcaaatcgtctcgtgaccgac
atcaagcgtgttttagaccacttcgacgcccgtcctccgaagctaatagaggtcgtgact
gcggccgtcgcacaagagaacagagaagccaacctcgatctgccaacgactcccgacgca
gtgaaggccactgcagcgttcaacgatatcgtcgtcgaagggcaccacggagggaagaag
aagcaacagcacggccatggccatggccaccacggccgtagccatagccatagccaccac
ggccgtagccatagccaccaccacagccacagcaaagacaaccacggcaagaaacccgcc
cttcacaagatgaacggagtttgctaa

DBGET integrated database retrieval system