KEGG   Physcomitrella patens subsp. patens: 112291657Help
Entry
112291657         CDS       T01041                                 

Definition
(RefSeq) sorbitol dehydrogenase-like isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00040  Pentose and glucuronate interconversions
ppp00051  Fructose and mannose metabolism
ppp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    112291657
   00051 Fructose and mannose metabolism
    112291657
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     112291657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Sacchrp_dh_NADP AlaDh_PNT_C Pyr_redox_2 PALP Methyltransf_25 TrkA_N
Motif
Other DBs
NCBI-GeneID: 112291657
NCBI-ProteinID: XP_024395168
LinkDB All DBs
Position
14
AA seq 369 aa AA seqDB search
MVLLKQPEGNEASVLNGSGGQNMAAWVCGKNDLKVQPYNLPPVLGDHEVKVGIKAVGICG
SDVHYYRHLQCGDFIVKEPMVIGHECAGTIEEVGKAVKNVAVGDRVALEPGIACNKCKLC
KQGFYNLCPDMEFFATPPVHGSLANHVIHPADMCFKLPENVSLEEGAMCEPLSVGVHACQ
RATVGPTTKVLILGAGPIGLVTLLAAHAFGSPTVVIADISPERLKVAKELGANATVVLST
SDNEVESEVLALQKAMGADIDVTIDCVGFTKSMKTALKATRAGGRVCLVGMGHNEMTLPL
TPAAAREVDILGVFRYRNTYPLCLDLISSGRVNVKPLITHRFGFNQKDVVDAFETSAKGG
SSIKVMFNL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggttttgctgaagcagcccgagggtaatgaggcctccgtgctcaatggatcgggaggc
cagaatatggcagcgtgggtttgtgggaagaacgacttgaaagtgcaaccctacaatttg
ccacccgttcttggtgaccatgaagtgaaagtgggaatcaaagctgtaggtatttgcggc
agcgatgtccattattacaggcacttgcaatgtggggattttatagtgaaggaacccatg
gttattggccatgaatgtgctggtaccattgaggaagttgggaaggctgtgaagaatgtt
gcagtgggtgatcgggtagctcttgagccaggcattgcttgcaacaaatgcaagctttgc
aagcaaggattctacaacttgtgcccagatatggaatttttcgccactccacctgtccat
ggatcccttgccaaccatgttattcatccagcggacatgtgttttaagctacccgagaat
gtgtcgcttgaggagggagccatgtgtgagcccctcagtgtgggtgtgcacgcgtgtcaa
cgtgcaacagttggaccaacaacaaaagttctgatattgggagcagggcctataggttta
gtcactttgcttgcagcccatgcgtttggaagcccgacggtcgtcatagcagacatctct
cctgaacgattgaaggttgcgaaggagctgggagcaaacgctacagtggtgctatccacc
agtgacaatgaggtggagtcagaggtactagctttgcagaaagccatgggagcagacatt
gatgtcacaatcgactgtgtgggattcactaagagcatgaagactgcattgaaggcaacc
cgagctgggggacgtgtttgtctcgttggcatgggccataacgaaatgacccttcccctc
acacctgctgccgcacgggaggtggacattcttggggtattccgctaccgcaacacgtac
ccactatgcttggacttgattagtagtgggcgtgtgaatgtgaagcccctcatcacacac
aggtttggattcaaccagaaggatgtggtggacgcctttgagacaagtgccaaaggaggc
agctctattaaggtcatgttcaacctttga

DBGET integrated database retrieval system