KEGG   Physcomitrella patens subsp. patens: 112292080Help
Entry
112292080         CDS       T01041                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00620  Pyruvate metabolism
ppp00710  Carbon fixation in photosynthetic organisms
ppp01100  Metabolic pathways
ppp01200  Carbon metabolism
Module
ppp_M00168  CAM (Crassulacean acid metabolism), dark
ppp_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ppp_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ppp_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    112292080
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    112292080
Enzymes [BR:ppp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     112292080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 112292080
NCBI-ProteinID: XP_024395990
LinkDB All DBs
Position
15
AA seq 969 aa AA seqDB search
MMLQKMASIDAQMRLLVPKRVSDDDKLIEYDALLLDRFLDILEELHGKELKDTVQDLYEL
SGLYSKTDGHGDVEKLRQLAEMLNNLDPGVNIVVASSFSHMLNLGNLAEEVQIALRRRVS
NAKKGDIGDENSALTESDMEETLHRLVKQLKKSPEEIFEALKDQTVDLVLTAHPTQAVRR
SLLQKHSRIRNCLSQMYQKDITADEKKELDEALQREIQAAFRTDEIRRSQPTPQDEMRAG
MSYFHETIWNGLPKFLRRVDTALKSIGVKERLPYNVKLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARLMAANLYFSQIEELMFELSMWRCSDELKARVLKIESLQRKEAKHYIEFWKHI
PPSEPFRVLLGDMRDKLYNTRERMRLLLQNGKSDIPIEDTYTDASQILEPLELCYRSLCE
TGDKPIADGSLLDFMRQVSCFGLSLVKLDIRQESDRHTDVIDAITNHLGIGSYRNWTEEQ
RQEWLLSELRGKRPLFGADLPTTEEIKDVLDTMKVVAELPQDCFGAYVISMATAPSDVLA
VELLQRECRIKKPLRVVPLFEKLADLEAAPAALSRLFSIDWYLNRINGKQEVMIGYSDSG
KDAGRLSAAWQMFKAQEDLVKVAKQYGVRLTMFHGRGGTVGRGGGPTHLAILSQPPDTIN
GSLRVTIQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPIAPKPEWRELMDAMAVAST
KEYRSIVFQNPSFVEYFRAATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGLGSALKQALQSDPRNIATFRRMYNQWPFFRVTIDLVEMVFAKGDPRIAALYD
DLLVSDELKPLGEELRQKYNETRDLLLKITFHDEILQGNPSLKQRLRLREPYITALNVQQ
ALVLKKMRDQGLQFCALQNSSKDQSDIPTTPKRAAELVELNPTTEFPPGLEDTLILTMKG
IAAGIQNTG
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgcaaaagatggcgtctattgacgctcagatgcggctactcgtgccgaaacga
gtgtccgatgacgacaagctcatcgagtacgacgcactgctgctcgatcggttcctggat
attctcgaagagcttcacggcaaagagctcaaggacacggtccaggatttgtacgaattg
tctgggttatactccaagacggatggccatggggacgtcgaaaagctccggcagcttgca
gaaatgctcaacaacctagaccctggagtgaacattgtggtagcaagttcattctcacac
atgcttaatcttggaaacttagccgaggaggtccaaattgctctgcgaaggcgtgtgtcg
aatgctaagaaaggtgatattggagatgagaacagtgcattgactgagtcggacatggag
gagacattgcatcggcttgtaaaacagctcaaaaaatcacctgaggagatcttcgaggca
ttgaaagaccaaactgtggaccttgtcttgacggcgcatcctactcaggctgtccgacgg
tcgcttcttcagaagcattctcggattcgaaattgtctatcacagatgtatcagaaagac
atcaccgcggacgaaaagaaagagctggacgaagctcttcaacgagagattcaagccgcc
tttcgcactgacgagatcaggcgatcccaacccacaccccaggatgagatgcgtgccggc
atgagctacttccacgaaacaatatggaacggtttgcccaagtttttgcgtcgtgtggac
accgcattgaagtcgattggagtcaaggagcgtcttccatacaatgtcaaactcatccaa
ttctcttcctggatgggtggcgatcgtgatggaaaccctcgtgtgacgccagaggttacc
agagatgtgtgtctgctggcccgactgatggcagcgaacctttatttctcccagattgag
gaactcatgtttgagctatcaatgtggcggtgcagcgatgagcttaaagcaagggtactg
aaaatcgagtcactgcaacgcaaggaggcaaaacactacattgaattctggaagcacatt
cctcccagtgagcctttcagggttttattaggagatatgcgtgacaaattatacaacaca
cgcgaacgcatgcggctattgttacagaatgggaaaagcgacattcctatcgaagacacg
tacactgatgcttcgcagattttggagccattagagctgtgttacaggtcgctttgtgag
actggcgataagcctattgcagatggaagtcttttggactttatgcgccaggtttcgtgt
tttggtttgagcttggtgaagttagacattcgacaggagtctgatcgtcatactgacgtt
attgatgccatcaccaaccaccttggcattggctcgtatcgcaactggactgaggagcaa
cgtcaggaatggcttctttctgaactccgtggaaagcgtcctctttttggagccgatcta
ccaacgacggaggagatcaaggatgttctggacacgatgaaagtcgttgccgagcttcct
caagattgctttggcgcatacgtcatttctatggcaacagctccgtctgatgttttagca
gtagagcttctgcaacgcgagtgtaggattaagaagccactgcgagtggtgcccttgttc
gagaagctcgctgacttggaagcagccccggcggccctttcacgcctattctcaattgac
tggtacctgaaccgtatcaatgggaagcaagaggtcatgataggatattcagattcagga
aaagatgcgggacgtctgtcggcagcgtggcaaatgttcaaagcacaggaggacttggtg
aaagttgccaagcagtatggtgttcgcctcactatgttccatggtcggggaggcacggtg
ggaaggggtggggggccaacccatcttgccattttgtcacagcctccggacacgattaac
gggtcattgcgagtgacaatccagggggaggtcattgagcaatccttcggtgaggagcat
ctctgtttcaggactttgcagcgttttacagcagctactctggagcacggaatgcaccct
cccatcgcccccaagcccgaatggagagagcttatggacgccatggccgtggcgtccacc
aaagagtaccgctccatcgtcttccagaacccaagttttgtagaatatttccgtgcggcg
acacccgagctggagtatgggcgcatgaacattggaagtcgtccatccaagcgcaaacca
agcggaggcattgagtcccttcgagccattccctggatttttgcttggacccagacacga
tttcatctgcctgtgtggcttggtcttggttctgccctaaaacaggcactgcagagtgac
cctaggaacattgccacttttcgccgaatgtacaatcagtggccctttttccgtgtgact
atcgacttggtggagatggtgtttgccaagggtgatccacgtattgccgctttatatgat
gacttgcttgtgtcggacgagctgaaaccgcttggcgaggagctgaggcagaagtacaac
gagacaagagatctccttctgaagataacattccacgatgaaatcttgcaagggaacccg
tcgctgaagcaacggctgcggcttcgagaaccctacatcacggctctcaacgtgcagcag
gcgctagtgctgaagaagatgcgtgatcagggcttgcagttctgtgcattacaaaacagc
agcaaggaccaatccgacataccaacaacacccaagcgtgctgcagagctggttgaactg
aaccccacaactgagttcccacccggactggaggatactctcattctcaccatgaagggt
atcgcggccggtattcaaaacactggatag

DBGET integrated database retrieval system