KEGG   Physcomitrella patens subsp. patens: 112292796Help
Entry
112292796         CDS       T01041                                 

Definition
(RefSeq) serine/threonine-protein kinase GRIK1-like isoform X1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppp01001]
    112292796
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     112292796
Protein kinases [BR:ppp01001]
 Serine/threonine kinases: Other
  CAMKK family
   112292796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Pkinase_fungal Seadorna_VP7 RIO1
Motif
Other DBs
NCBI-GeneID: 112292796
NCBI-ProteinID: XP_024397391
LinkDB All DBs
Position
2
AA seq 478 aa AA seqDB search
MDEDYSCCGLIRFKKKCSARDVKPSSKPIVKRISKEHLLRYEAEEIEKAAVKLKTSRQAT
KSAPLNLYNPPLKVTVGNDHVVERKTTFKELQEAMKRARNAQAPLLSRESVKETSHEFRS
RDADGNKMVNEYVWKCKIGAGSYGKVVLYQSKKDEKLYAIKVFHKSRLRKVRVSPSETAM
TDVLREVSIMKRLDHPNIVKLFEVIDDPHSDNIYLVLSYVEGNRIFEGSGPPGGIGEALA
RKYFRDVVAGLSYLHSHNIIHGDIKPENLLLSGDGSIKICDFGVSRMFEGDDTVRRTPGT
PIHTAPECFSGSCYHGRPADVWALGCTLYCMVFGRYPFVGDTTYPSIYDEIVNKPLFIPE
GTNPDLADLLQGLLCKGKCADPTSNNGRVYSPMAQSWLRTSSIDLLQDGVRTPASLPCDR
TFICKRERRVRKSGLTKVQKTQTSCEGDEEATAKSQTVHVGVCVYIYIYIYRYILYLC
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggattactcttgttgtggactaatccggttcaaaaagaaatgttcagcgcgg
gatgttaagccctcatcgaagccgatcgtcaaaagaatctctaaagagcatttgcttcgc
tatgaagccgaggagattgagaaggctgctgtgaagctaaagacaagccgacaggctacc
aaatctgcccctctcaatctctataacccgccgcttaaagtgaccgtcggaaatgatcat
gttgttgaaaggaaaactacctttaaagagctccaagaagcgatgaaacgagcccgtaat
gcacaagcgccgcttctgagccgagaaagcgtgaaggagacttctcatgaatttcgatcc
agggacgcggatggcaacaaaatggtgaacgaatatgtgtggaagtgcaagattggagct
ggaagctatggcaaagtggttttgtaccagagtaagaaagacgagaagctgtatgctatc
aaggtctttcacaagtctcgtctgcgcaaagtgcgggtttccccctcggaaactgctatg
acagatgtgcttcgagaggtgtctataatgaagcggctcgatcaccccaacattgtaaag
ctttttgaggttattgatgatccgcatagtgataacatatatttggtgctgagttacgtt
gagggcaaccggatttttgaaggcagcggacctcctgggggtattggcgaagcacttgcc
cggaaatattttcgagatgttgttgcaggcctttcatatcttcatagccataacatcatc
cacggtgacataaaacctgaaaatcttctcctaagtggagatggttctatcaaaatatgc
gattttggtgtcagtcggatgtttgagggggatgacactgtaaggcgaacccctgggact
ccaatacatacagctcctgaatgtttctcaggatcgtgttaccacggacgcccagcagac
gtctgggctttgggttgcacgctatactgcatggtgtttggccgctacccgttcgtgggg
gataccacatatccgtctatctatgatgagattgtgaacaagcccttgttcatcccagag
ggcacgaacccggatctagctgatttgctacaaggtcttctgtgcaaaggcaaatgtgcg
gatccgacttccaataacggtcgtgtctactcacccatggctcaatcatggctacggaca
agttcaatcgacctgttacaagacggcgtacgaactccagcatccttaccctgcgacagg
accttcatttgtaaacgggaacgtcgagttagaaaatctggtttgacaaaagtacaaaaa
actcaaacatcctgcgaaggtgatgaagaagcaacggctaaatcccaaacggtacatgtg
ggtgtgtgtgtgtacatatatatatatatatatagatatatattatatctttgttag

DBGET integrated database retrieval system